DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and Lcmt1

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_955437.1 Gene:Lcmt1 RGDID:735118 Length:332 Species:Rattus norvegicus

Alignment Length:303 Identity:150/304 (49%)
Similarity:203/304 (67%) Gaps:7/304 (2%)


  Fly    20 DEAVIATNDDASDCKRCAVRLGYWKDDYIGYFVR-NQERKAPEINRGYFARVKGVEMCVEKFLKK 83
            ||.|..|.:|||.|||.||.:|:|.|.||.:.|| ::|||||||||||||||.||...::.||:|
  Rat    21 DEGVRGTCEDASLCKRFAVSIGHWHDPYIEHLVRQSKERKAPEINRGYFARVHGVSQLIKAFLRK 85

  Fly    84 TSGNCQIINLGCGFDTLYFRLRDTAHQVKNFIELDFPTVTARKCYTIKRNKALLAR----IHDED 144
            |...|||:|||.|.||.:::|:|.......:.|:|||.:..||.:||| ||.||.|    :|.||
  Rat    86 TECRCQILNLGAGMDTTFWKLKDEGLLPNKYFEVDFPMIVTRKLHTIK-NKPLLFRPIMELHPED 149

  Fly   145 GEVRLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNLLKW 209
             .:::....|....|.::|.|||:|.|::.||::..::..|||:.:.||||||:..:...|||||
  Rat   150 -TLQIDSHMLDSKRYAIIGADLRDLSELEEKLKKCNMNTQLPTLLITECVLVYMTPEQSANLLKW 213

  Fly   210 IAQKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGARAWD 274
            .|:.|:.|:|:|||||||:||||.:|:.|||.|.|.|||||:|.||::|:.|...:||..|.|.:
  Rat   214 AARSFETAMFINYEQVNMDDRFGQIMIENLRRRQCDLAGVETCKSLESQKERLLLNGWETASAVN 278

  Fly   275 MVQVYESISAAERQRIERLEMLDEGELLLQLFQHYCLVVAWLG 317
            |:::|..:..||..|||.||.|||.|||.||.:||||..|..|
  Rat   279 MMELYSGLPRAEVNRIESLEFLDEMELLEQLMRHYCLCWATRG 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 90/194 (46%)
Lcmt1NP_955437.1 LCM 24..215 CDD:281992 90/193 (47%)
S-adenosyl-L-methionine binding. {ECO:0000250} 169..170 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C221762736
eggNOG 1 0.900 E1_KOG2918
Hieranoid 1 1.000
Homologene 1 1.000 H41123
Inparanoid 1 1.050 290 1.000 Inparanoid score I2673
OMA 1 1.010
OrthoDB 1 1.010 D1094856at2759
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 1 1.000 T1086051
orthoMCL 1 0.900 OOG5_126898
Panther 1 1.100 LDO PTHR13600
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.