DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and Lcmt2

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_808514.2 Gene:Lcmt2 MGIID:1353659 Length:686 Species:Mus musculus

Alignment Length:331 Identity:119/332 (36%)
Similarity:166/332 (50%) Gaps:22/332 (7%)


  Fly    23 VIATNDDASDCKRCAVRLGYWKDDYIGYFVRNQERKAPEINRGYFARVKGVEMCVEKFLKKTSG- 86
            |.:|||.:|..||.....||.:|.:....|....|:.|.|:|||:.|.:.|..||..||:.||. 
Mouse    13 VQSTNDSSSLSKRSLAAHGYVRDPFAALLVPGPVRRTPLIHRGYYVRARAVRHCVRAFLELTSAL 77

  Fly    87 ----NCQIINLGCGFDTLYFRLRDTAHQVKNFI-ELDFPTVTARKCYTIKRNKALLA-----RIH 141
                ..||::||.|.|:|||||:......:..: |:|||.|:..|...|:....|.|     :|.
Mouse    78 PSRTRAQILSLGSGSDSLYFRLKAAGLLARAAVWEVDFPDVSRLKAERIEETPELRAQTGPFKIG 142

  Fly   142 DEDGEVRLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNL 206
            |....:.....|     |.::|.|||.|..:...|..|.:|.:.||:.|||.||.|:|..:...|
Mouse   143 DSASSLCFESAD-----YRILGADLRELQRLGEALDGAGLDATSPTLLLAEAVLTYLEPSSATAL 202

  Fly   207 LKWIAQKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGAR 271
            :.|.||:|..|:||.|||:...|.||.:||.:.:.....|.|:|....:..||.||..:|||...
Mouse   203 IAWAAQRFPDALFVIYEQMQPGDAFGQIMLQHFQRLHSPLHGLELFPVVKAQRQRFLQAGWTACS 267

  Fly   272 AWDMVQVYES-ISAAERQRIERLEMLDEGELLLQLFQHYCLVVAWLGVAFQDIDITCVPVVEELM 335
            |.|:.:.|.. :||.||||:|.||..||.|.......||.::.|..|    || ::..||.|...
Mouse   268 ALDLNEFYRRLLSAEERQRVETLEPFDEYEEWHLKCSHYFILAASRG----DI-LSETPVFEPSE 327

  Fly   336 SSLNID 341
            :|..||
Mouse   328 ASFQID 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 68/199 (34%)
Lcmt2NP_808514.2 LCM 26..207 CDD:281992 61/186 (33%)
S-adenosyl-L-methionine binding. {ECO:0000250} 161..162 1/1 (100%)
Kelch_3 494..542 CDD:290151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2918
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126898
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2177
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.