DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and Lcmt1

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_079580.2 Gene:Lcmt1 MGIID:1353593 Length:332 Species:Mus musculus

Alignment Length:323 Identity:154/324 (48%)
Similarity:209/324 (65%) Gaps:16/324 (5%)


  Fly     9 IAGSTHK--FHPC-------DEAVIATNDDASDCKRCAVRLGYWKDDYIGYFVR-NQERKAPEIN 63
            :|.|:.:  |..|       ||.|..|.:|||.|||.||.:|||.|.||.:.|| ::||||||||
Mouse     1 MASSSRESSFSSCSSSCDLDDEGVRGTCEDASLCKRFAVSIGYWHDPYIEHLVRQSKERKAPEIN 65

  Fly    64 RGYFARVKGVEMCVEKFLKKTSGNCQIINLGCGFDTLYFRLRDTAHQVKNFIELDFPTVTARKCY 128
            |||||||.||...::.||:||..:|||:|||.|.||.:::|:|.......:.|:|||.:..||..
Mouse    66 RGYFARVHGVSQLIKAFLRKTECHCQILNLGAGMDTTFWKLKDEGLLPNKYFEVDFPMIVTRKLL 130

  Fly   129 TIKRNKALLAR----IHDEDGEVRLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIF 189
            ||| :|.||.|    :|.|| .:::....|....|.::|.|||:|.|::.||::..::..|||:.
Mouse   131 TIK-SKPLLFRPIMELHPED-TLQMDSHMLDSKRYAIIGADLRDLSELEEKLKKCNMNTQLPTLL 193

  Fly   190 LAECVLVYIEAQNCRNLLKWIAQKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLS 254
            :.||||||:..:...|||||.|..|:.|:|:|||||||:||||.:|:.|||.|.|.|||||:|.|
Mouse   194 ITECVLVYMTPEQSANLLKWAASSFETAMFINYEQVNMDDRFGQIMIENLRRRSCDLAGVETCKS 258

  Fly   255 LDTQRNRFKDSGWTGARAWDMVQVYESISAAERQRIERLEMLDEGELLLQLFQHYCLVVAWLG 317
            |::|:.|...:||..|.|.:|:::|..:..||..|||.||.|||.|||.||.:||||..|..|
Mouse   259 LESQKERLLLNGWETASAVNMMELYSGLPRAEVNRIESLEFLDEMELLEQLMRHYCLCWATRG 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 90/194 (46%)
Lcmt1NP_079580.2 LCM 24..215 CDD:281992 90/193 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C221763160
eggNOG 1 0.900 E1_KOG2918
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41123
Inparanoid 1 1.050 290 1.000 Inparanoid score I2772
Isobase 1 0.950 0.815465 Normalized mean entropy S2071
OMA 1 1.010
OrthoDB 1 1.010 D1094856at2759
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126898
Panther 1 1.100 LDO PTHR13600
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2177
TreeFam 1 0.960
1312.750

Return to query results.
Submit another query.