DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and Lcmt2

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001011956.1 Gene:Lcmt2 RGDID:1305829 Length:686 Species:Rattus norvegicus

Alignment Length:331 Identity:117/332 (35%)
Similarity:163/332 (49%) Gaps:22/332 (7%)


  Fly    23 VIATNDDASDCKRCAVRLGYWKDDYIGYFVRNQERKAPEINRGYFARVKGVEMCVEKFLKKTSG- 86
            |.:|||.:|..||.....||..|.:....|....|:.|.|:|||:.|.:.|..||..||..|.. 
  Rat    13 VQSTNDSSSLSKRSLAAQGYVSDAFAPLLVPGIVRRTPLIHRGYYVRARAVRHCVRAFLDLTGAI 77

  Fly    87 ----NCQIINLGCGFDTLYFRLRDTAHQVKNFI-ELDFPTVTARKCYTIKRNKALLA-----RIH 141
                ..||::||.|.|:|||||:......:..: |:|||.|:..|...|:....|.|     :|.
  Rat    78 RSPTRAQILSLGSGSDSLYFRLKAAGLLTRTAVWEVDFPDVSRLKAKRIEETPELCAQTGPFKIG 142

  Fly   142 DEDGEVRLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNL 206
            |....:....:|     |.::|.|||.|..:...|..|.:|.:.||:.|||.||.|:|......|
  Rat   143 DSASTLCFESSD-----YRILGADLRELQRLGEALDSAGLDATSPTLILAEAVLTYLEPSRAAAL 202

  Fly   207 LKWIAQKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGAR 271
            :.|:||:|..|:||.|||:...|.||.:||.:.|.....|.|:|....::.||.||..:|||...
  Rat   203 IAWVAQRFPNALFVIYEQMKPGDAFGQIMLQHFRRLNSPLHGLELFPDVEAQRQRFLQAGWTTCS 267

  Fly   272 AWDMVQVYES-ISAAERQRIERLEMLDEGELLLQLFQHYCLVVAWLGVAFQDIDITCVPVVEELM 335
            |.|:.:.|.. |.|.||:|:|.||..||.|.......||.::.|..|    || ::..||.....
  Rat   268 ALDLNEFYRRLIPADERRRVETLEPFDEFEEWHLKCSHYFILAASRG----DI-LSETPVFLPSE 327

  Fly   336 SSLNID 341
            :|..||
  Rat   328 ASFQID 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 67/199 (34%)
Lcmt2NP_001011956.1 LCM 26..207 CDD:281992 60/186 (32%)
S-adenosyl-L-methionine binding. {ECO:0000250} 161..162 1/1 (100%)
Kelch_3 494..542 CDD:290151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2918
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094856at2759
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.