DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and SPBP8B7.08c

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_596515.1 Gene:SPBP8B7.08c PomBaseID:SPBP8B7.08c Length:310 Species:Schizosaccharomyces pombe

Alignment Length:308 Identity:107/309 (35%)
Similarity:155/309 (50%) Gaps:15/309 (5%)


  Fly    23 VIATNDDASDCKRCAVRLGYWKDDYIGYF--VRNQERKAPEINRGYFARVKGVEMCVEKFLKKTS 85
            :..|:.||..|:..|.:.||..|.:|.:|  .|| ..|.|.||||.:.|...::..::||::...
pombe     3 ITETDLDALKCRSSATKSGYIHDPFIKFFSPSRN-SHKPPIINRGTYVRTWSIDHILQKFIESFD 66

  Fly    86 GNCQIINLGCGFDTLYFR-LRDTAHQVKNFIELDFPTVTARKCYTIKRNKALLARIHDEDGEVRL 149
            |..|||:||.|.||..|| :.:...:...|||.||.....||..||::::||...|.|.  .|.:
pombe    67 GKKQIISLGAGTDTRVFRYISEYGPENLKFIEFDFYPNCIRKIRTIEKHEALKQNIGDY--VVDI 129

  Fly   150 SPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNLLKWIAQKF 214
            |...|...|..:...|:|   |:..|.....||:|||||.|:||.|.|:|.:...:|.:|....|
pombe   130 SGGSLVSGSLDIYSYDIR---EIVHKGFPGFVDFSLPTIVLSECCLCYLEPEEASSLCRWFQNMF 191

  Fly   215 QAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGARAWDMVQVY 279
            ..:..|.||.:...|.||.:|..||..||..|..::...:.:.||.||.|.|::...|.|.:.:.
pombe   192 ATSGIVVYEPIQGMDNFGKMMKANLSARGVILKTLDCYETTEQQRMRFLDYGYSEVIAEDFLTIE 256

  Fly   280 ES-ISAAERQRIERLEMLDEGELLLQLFQHYCLVVA-----WLGVAFQ 321
            |: |...|::|...:|||||.|....|.:||||..|     |..:..|
pombe   257 ETWIPIEEKKRTMSIEMLDELEEWQLLAKHYCLTFAATENLWNQIILQ 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 68/191 (36%)
SPBP8B7.08cNP_596515.1 LCM 6..186 CDD:281992 67/186 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I1283
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 1 1.000 T1124308
orthoMCL 1 0.900 OOG5_126898
Panther 1 1.100 LDO PTHR13600
Phylome 1 0.910 0.652 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2177
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.