DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and SPBC19C7.08c

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_596164.1 Gene:SPBC19C7.08c PomBaseID:SPBC19C7.08c Length:681 Species:Schizosaccharomyces pombe

Alignment Length:306 Identity:86/307 (28%)
Similarity:153/307 (50%) Gaps:17/307 (6%)


  Fly    20 DEAVIATNDDASDCKRCAVRLGY----WKDDYIGYFVRNQERKAPEINRGYFARVKGVEMCVEKF 80
            |..|..|||.:...|....:.||    ....|...|::...|::|.:||||:.|...:...|.:|
pombe    13 DREVRKTNDSSILSKASVEKCGYPGFTVGHSYYQPFIQKSPRRSPSVNRGYWTRCMAIRFAVYQF 77

  Fly    81 LK-KTSGNCQIINLGCGFDTLYFRLRDTAHQVKN----FIELDFPTVTARKCYTIKRNKALLARI 140
            || ||.....|:|||.|:|.|.|:|. ::|:...    |.::|:|.....:...| |:.:.|:.|
pombe    78 LKNKTGKRKAIVNLGAGYDPLAFQLL-SSHEYNTDDVVFYDVDYPETIENRVQMI-RSDSFLSSI 140

  Fly   141 HDEDGEVRLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTI-FLAECVLVYIEAQNCR 204
            ..||.|..|..|::|..:||..|.:|..|::::|.|::..:||....| |::|...||:..|...
pombe   141 VLEDKEFDLDGTEIHTKNYHSFGCNLNLLNQLESCLEKYGIDYCNDAILFISEVAAVYMPRQASE 205

  Fly   205 NLLKWIAQKFQAAVFVNYEQV---NMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSG 266
            .|::|:: ||..|....:||:   ..:..|.:||:.:.:..|..|.|:.:..::::.::|:..:|
pombe   206 KLIRWMS-KFPDAHSCFFEQIAPATFDHPFANVMVKHFKEWGTPLHGLYAYPTIESLKSRWVKNG 269

  Fly   267 WTGARAWDMVQVYESISAAERQRI-ERLEMLDEGELLLQLFQHYCL 311
            |......|:...:..:..::.:.: |.:|..||.|......|||.:
pombe   270 WEYVEILDVCTFWNFLMDSKLKHLCEMVEPFDEWEEFYFFLQHYSI 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 62/199 (31%)
SPBC19C7.08cNP_596164.1 AdoMet_MTases <39..212 CDD:302624 55/175 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126898
Panther 1 1.100 O PTHR13600
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2177
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.