DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and lcmt-1

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_497875.1 Gene:lcmt-1 WormBaseID:WBGene00007137 Length:333 Species:Caenorhabditis elegans

Alignment Length:305 Identity:129/306 (42%)
Similarity:185/306 (60%) Gaps:11/306 (4%)


  Fly    20 DEAVIATNDDASDCKRCAVRLGYWKDDYIGYFVR-----NQERKAPEINRGYFARVKGVEMCVEK 79
            |.:|..|||||:.||..|.:.|||||::|..|..     ::.|:.|||:.||:||...:|..|..
 Worm    28 DYSVQRTNDDATQCKYFATQKGYWKDEFISRFANSSSNVSEARRFPEISMGYWARTAAIEKYVRD 92

  Fly    80 FLKKTSGNCQIINLGCGFDTLYFRLRDTAHQVKNFIELDFPTVTARKCYTIKR----NKALLARI 140
            ||.:..||.|:::||||||||::||..:..::..::|:||.:||::|...|.:    |...|.:.
 Worm    93 FLNEFDGNAQVVSLGCGFDTLFWRLVSSGAKLVKYVEVDFSSVTSKKIRHILKPIGPNSVDLKKS 157

  Fly   141 HDEDGEVRLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRN 205
            .:.|..|. ...|||..:|||:|.|||..:|:|.||...::.:.:||||:|||||||:.|.:...
 Worm   158 FESDAVVS-HHADLHAGNYHLIGADLRQANELDQKLATCQLSHDIPTIFIAECVLVYMSADSSTA 221

  Fly   206 LLKWIAQKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGA 270
            |||.|..:|:...||||||...:|.|..||..||..||..|.|:|.|.|.:.|..||:::|:...
 Worm   222 LLKQIVSQFKQPAFVNYEQFRTSDAFTKVMEQNLGDRGIQLHGLEMCESAEKQEERFRNAGFKEV 286

  Fly   271 RAWDMVQVYES-ISAAERQRIERLEMLDEGELLLQLFQHYCLVVA 314
            :..||.|::.: :...|..||..:|||||.|||.|||.|||:|.|
 Worm   287 KVMDMNQIFNNFLDQKEVSRIREIEMLDEMELLQQLFAHYCVVSA 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 82/198 (41%)
lcmt-1NP_497875.1 LCM 30..226 CDD:281992 81/197 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C221766288
eggNOG 1 0.900 E1_KOG2918
Hieranoid 1 1.000
Homologene 1 1.000 H41123
Inparanoid 1 1.050 243 1.000 Inparanoid score I2053
Isobase 1 0.950 0.815465 Normalized mean entropy S2071
OMA 1 1.010
OrthoDB 1 1.010 D1094856at2759
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 1 1.000 T476097
orthoMCL 1 0.900 OOG5_126898
Panther 1 1.100 LDO PTHR13600
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2177
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.