DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and TYW5

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001034782.1 Gene:TYW5 HGNCID:26754 Length:315 Species:Homo sapiens

Alignment Length:109 Identity:20/110 (18%)
Similarity:35/110 (32%) Gaps:24/110 (22%)


  Fly     4 PASAGIAGSTHKFH--PCDEAVIATNDDASDCKRCAVRLGYWKDDYIGYFVRNQERKAPEINRGY 66
            |...|::......|  |..:.::....|...|      ...|..||:......:|.|.      :
Human     9 PRLEGVSREQFMQHLYPQRKPLVLEGIDLGPC------TSKWTVDYLSQVGGKKEVKI------H 61

  Fly    67 FARVKGVEMCVEKFLKKTSGNCQIINLGCGFDTLYFRLRDTAHQ 110
            .|.|..::...:.|:.:|          ..||.|..|..:..|:
Human    62 VAAVAQMDFISKNFVYRT----------LPFDQLVQRAAEEKHK 95

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 16/90 (18%)
TYW5NP_001034782.1 Cupin_8 17..255 CDD:316171 18/102 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126898
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.