DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and lcmt2

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001119971.1 Gene:lcmt2 XenbaseID:XB-GENE-5944136 Length:289 Species:Xenopus tropicalis

Alignment Length:160 Identity:55/161 (34%)
Similarity:78/161 (48%) Gaps:1/161 (1%)


  Fly   159 YHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNLLKWIAQKFQAAVFVNYE 223
            |.|:||||..:..:|:.|..|.:.:..||:.|.|..|.|::......|:.|.|::|:.:.||.||
 Frog     5 YKLLGVDLTEVSSLDAALNLAGLSWDCPTLVLGEVALCYMDPARSTALIGWAAERFRDSRFVLYE 69

  Fly   224 QVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGARAWDMVQVYES-ISAAER 287
            |...:|.||.||.::.......|..:.....:..|..||...||...||.||.:...| :...|.
 Frog    70 QSCPSDPFGRVMTSHFASLNSPLLSLSEFPHIQDQEQRFLHKGWKTCRALDMNEFCASCVPLPEV 134

  Fly   288 QRIERLEMLDEGELLLQLFQHYCLVVAWLG 317
            |||..||..||.|.|.....||.::||..|
 Frog   135 QRIHNLEPFDEFEELHLKCSHYFILVASQG 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 17/52 (33%)
lcmt2NP_001119971.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2918
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094856at2759
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.