DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3793 and lcmt2

DIOPT Version :9

Sequence 1:NP_001246038.1 Gene:CG3793 / 34928 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_031753467.1 Gene:lcmt2 / 100144923 XenbaseID:XB-GENE-5944136 Length:895 Species:Xenopus tropicalis


Alignment Length:302 Identity:107/302 - (35%)
Similarity:157/302 - (51%) Gaps:11/302 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VIATNDDASDCKRCAVRLGYWKDDYIGYFVRNQERKAPEINRGYFARVKGVEMCVEKFLKKTSGN 87
            |.:|||.::..|..|..|||::|:|...||....|::|.|:|||..|.:.|..|:.:|::.|. :
 Frog   235 VQSTNDCSTLSKVSAASLGYFEDEYQKNFVNRNCRRSPLIHRGYCVRSQAVTHCINEFIRDTQ-S 298

  Fly    88 C---QIINLGCGFDTLYFRLRDTAHQVKNFIELDFPTVTARKCYTIKRN---KALLARIHDEDGE 146
            |   |:::||||||:|:||||..:.......|:|||:|..|||..|:::   :.||......||.
 Frog   299 CDHRQVVSLGCGFDSLFFRLRMQSESPLCVWEVDFPSVVKRKCLLIEQSGDLRDLLGSYVTPDGN 363

  Fly   147 VRLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNLLKWIA 211
               .|..|....|.|:||||..:..:|:.|..|.:.:..||:.|.|..|.|::......|:.|.|
 Frog   364 ---GPLVLLSQGYKLLGVDLTEVSSLDAALNLAGLSWDCPTLVLGEVALCYMDPARSTALIGWAA 425

  Fly   212 QKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGARAWDMV 276
            ::|:.:.||.|||...:|.||.||.::.......|..:.....:..|..||...||...||.||.
 Frog   426 ERFRDSRFVLYEQSCPSDPFGRVMTSHFASLNSPLLSLSEFPHIQDQEQRFLHKGWKTCRALDMN 490

  Fly   277 QVYES-ISAAERQRIERLEMLDEGELLLQLFQHYCLVVAWLG 317
            :...| :...|.|||..||..||.|.|.....||.::||..|
 Frog   491 EFCASCVPLPEVQRIHNLEPFDEFEELHLKCSHYFILVASQG 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:397957 69/193 (36%)
lcmt2XP_031753467.1 AdoMet_MTases 247..425 CDD:418430 64/181 (35%)
KELCH repeat 685..736 CDD:276965
KELCH repeat 740..787 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094856at2759
OrthoFinder 1 1.000 - - FOG0001575
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.