DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and lcmt2

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001122029.1 Gene:lcmt2 ZFINID:ZDB-GENE-110714-2 Length:673 Species:Danio rerio

Alignment Length:305 Identity:110/306 (36%)
Similarity:160/306 (52%) Gaps:8/306 (3%)


  Fly    20 DEAVIATNDDASDCKRCAVRLGYWKDDYIGYFVRNQERKAPEINRGYFARVKGVEMCVEKFLKKT 84
            |.||..|||.:...|..|...||:.||::.:||....|:||.|||||:.|.|.|:.||::||..|
Zfish    12 DAAVQGTNDSSVVSKVSAAAQGYFHDDFLKHFVCKMSRRAPLINRGYYVRWKAVDHCVKQFLHAT 76

  Fly    85 SGNC---QIINLGCGFDTLYFRLR-DTAHQVKNFIELDFPTVTARKCYTIKRNKALLARIHDEDG 145
            . :|   ||::||.|||:|:|||| :.|.......|:|||.|..||...|..|..|...:.|.:.
Zfish    77 K-SCSRRQILSLGAGFDSLFFRLRAEGALGGVTVFEVDFPEVARRKAALINSNACLKDLLPDWET 140

  Fly   146 EV--RLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNLLK 208
            .:  :.:...:....|:|:|.|:|...||::.|..|.:.:..||:.|:|.||.|:|.|....::.
Zfish   141 VLNKQTNAVFISSGHYNLIGADVRKEQEVEASLSAAGLQWDNPTLILSEVVLTYMETQWSDAVIG 205

  Fly   209 WIAQKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGARAW 273
            |.|:....::||.|||::.:|.||.||.::.......:..::.......|..||...||......
Zfish   206 WAARLLPQSMFVMYEQIHPDDPFGRVMQSHFLKLNSKIHSLQQYPDNVAQTQRFIQEGWEKCHCL 270

  Fly   274 DMVQVY-ESISAAERQRIERLEMLDEGELLLQLFQHYCLVVAWLG 317
            ||.|.| :.:...||||||.||..||.|...|...||.::.|..|
Zfish   271 DMNQFYFDLLPEDERQRIENLEPFDEFEEWHQKCSHYFILTASKG 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 73/195 (37%)
lcmt2NP_001122029.1 LCM 28..208 CDD:281992 67/181 (37%)
Kelch_4 465..512 CDD:290154
KELCH repeat 466..517 CDD:276965
KELCH repeat 521..570 CDD:276965
Kelch_3 530..578 CDD:290151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2918
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094856at2759
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126898
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2177
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.