DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and Ces5a

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:XP_006531383.1 Gene:Ces5a MGIID:1915185 Length:579 Species:Mus musculus

Alignment Length:635 Identity:170/636 (27%)
Similarity:274/636 (43%) Gaps:132/636 (21%)


  Fly   111 GVLAGWREDLQGKQRRDSLTLERDVFVTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGEC 175
            |.:||            |:|.|...:  |..|.|||.:..:....:|                 .
Mouse    25 GAMAG------------SVTEEPHRY--TKLGWVQGKQATVLGRLEP-----------------V 58

  Fly   176 SVFLGIPYALPPTFEGRFKPPRVHRGW-QLLQAVDFGPACPQPVR----YTGATK---GIMDMDE 232
            :||||||:|.||....||..|:....| .|.:|..:...|.|.:.    |....|   .|:.|.|
Mouse    59 NVFLGIPFAAPPLGPLRFSKPQPPIPWDNLREATAYPNLCFQNLEWLFIYQNLLKVSYPILGMSE 123

  Fly   233 DCLYLNVYSPKTGAGVAQKYPVMVYIHGGEFIRGASNLFQGHILASFYDVVVVTLNYRLGALGFL 297
            ||||||:|:| ..|......||||:|.||.|..|::::|.|..||.:.||:|||:.||||..||.
Mouse   124 DCLYLNIYAP-CHANNGSSLPVMVWIPGGGFETGSASIFDGSALAVYEDVLVVTIQYRLGIFGFF 187

  Fly   298 STGDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNIVRRV 362
            :|.::::|||:...||..||.||.:||::|.|:.:|:|:||..||..|...|:::|.:.::..|.
Mouse   188 TTQNQHAPGNWAFWDQLAALLWVRENIKYFGGNPDSVTIFGNSAGAISISSLILSPLSADLFHRA 252

  Fly   363 IAQSGSALADWALIQDKYRAQNTSRVLGQLLGCSIESSWKLVNCLRTGRSFYELGNAEFSPQVGS 427
            |.|||.|:.. :|.......::..:|:..:..|::..|..|:.|||. :|..||  ...|.:..|
Mouse   253 IMQSGVAIIP-SLKSSDNDLKHDLQVVANVCDCNVSDSKALLKCLRE-KSSLEL--MSLSQKAKS 313

  Fly   428 FPWGPVLDHNFTLPGDDWYEGWREKDWRFLTQTPETLIRAGKFNRNIQYMTGVTTQEAAF----- 487
            |.                    |..|..|.::.|..|: :.|..:.:..:.||..||..:     
Mouse   314 FT--------------------RVVDGSFFSEEPLELL-SQKTLKIVPSIIGVNNQECGYILPVR 357

  Fly   488 -----FVAQNESLSPYYELDGRFFDQKIREHVFRYNYTLNPNGVYEAIKYIY----TFWPDPNNN 543
                 .:..|||.:                      .||....::...:::|    .::...::.
Mouse   358 DTPEILLGSNESTA----------------------LTLIHTLLHIPTQHLYIVTKEYFHGKHSP 400

  Fly   544 TIIRDQYINMLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEAL--NLPQWRKYPHDIERYFL 606
            |.|||..:::..|:::..|.....:...:...|||.|.........  :.|.:.|..|..|..|:
Mouse   401 TDIRDTLLDLFGDVFFVVPGLVTARYHRDSGGPVYFYEFQHRPHCFQNSRPAFVKADHTDEIRFV 465

  Fly   607 TGAPFM--DTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYGNPT-----PQQVLGMHFQR 664
            .|.||:  |...|.:.        |:.::.:|...|:.:.||||.|:|.     |..|       
Mouse   466 FGGPFLKGDVVMFEEA--------TEEEKLLSRKMMKYWANFARSGDPNGADLPPWPV------- 515

  Fly   665 AYQGEIRYLNINTTYNSSILLNYRQTECAFWTQYLPTVI----GVLVPTY 710
             |....:||.::...::...|..::.|  |||..||.::    .:|.||:
Mouse   516 -YDENEQYLELDVNISTGRRLKDQRVE--FWTDTLPLILSASKALLSPTF 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 157/592 (27%)
Ces5aXP_006531383.1 COesterase 35..543 CDD:278561 157/593 (26%)
Aes <130..>233 CDD:223730 47/104 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89818511
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.