DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and LOC679149

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001094469.1 Gene:LOC679149 RGDID:1591847 Length:561 Species:Rattus norvegicus

Alignment Length:617 Identity:168/618 (27%)
Similarity:261/618 (42%) Gaps:125/618 (20%)


  Fly   120 LQGKQRRDSLTLERDVFVTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYA 184
            :||:...:|..:.     .|:.|||:|...::.|                 .......|||||:|
  Rat    24 VQGQHSPESSPIR-----NTHIGQVRGKLDHVKD-----------------TKAGVHTFLGIPFA 66

  Fly   185 LPPTFEGRFKPPRVHRGWQLLQAVDFGPA-CPQPVRYTGATKGI---------MDMDEDCLYLNV 239
            .||....||.||.....|..::.....|| |.|.:....| :|:         :.|.|||||||:
  Rat    67 KPPVGPLRFAPPEAPEPWSGVRDGTSQPAMCLQNLDVINA-EGLKEMKLKLPPVSMSEDCLYLNI 130

  Fly   240 YSPKTGAGVAQKYPVMVYIHGGEFIRGASNLFQGHILASFYDVVVVTLNYRLGALGFLSTGDENS 304
            |:| ..|......||||:||||..:.|.::::.|.:|....|:||||:.||||.|||.|||||::
  Rat   131 YAP-AHAHEGSNLPVMVWIHGGGLMTGMASMYDGSLLTVNEDLVVVTIQYRLGVLGFFSTGDEHA 194

  Fly   305 PGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNIVRRVIAQSGSA 369
            .||:|.|||..|||||..||..|.|:.:.:|:||..|||......:|:|.::.:....|.:||.|
  Rat   195 RGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTCVSTHVVSPMSQGLFHGAIMESGVA 259

  Fly   370 LADWALIQDKYRAQNTSRVLGQLLGCSIESSWKLVNCLRTGRSFYEL----GNAEFSPQVGSFPW 430
            |..: ||.|  .::..|.::.::.||....|..||:||| .:|..|:    ...:..|.|     
  Rat   260 LLPY-LIAD--TSEMFSTMVAKVSGCEAMDSEALVHCLR-AKSEAEILAINKVVQMVPAV----- 315

  Fly   431 GPVLDHNFTLPGDDWYEGWREKDWRFLTQTPETLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESL 495
                                 .|..||.:.|:.|:.:..| |.:..:.||...|..:.:......
  Rat   316 ---------------------VDGEFLPRHPKELLASEDF-RPVPSIIGVNNDEYGWTIPLVMGT 358

  Fly   496 SPYYELDGRFFDQKIREHVFRYNYTLNPNGVYEAIK---------------YIYTFWPDPNNNTI 545
            :           |.|:|        |:...:...:|               .:..:..|..:...
  Rat   359 T-----------QMIKE--------LSRENLQAILKKTTAQLMLPLECSDLLMEEYMGDIEDPKT 404

  Fly   546 IRDQYINMLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEALN--LPQWRKYPHDIERYFLTG 608
            ::.|:..::.|..:..|..|:....... .|||.|.....:..|.  .|...|..|..|..|:.|
  Rat   405 LQAQFTELMEDFMFVIPALQVAHFQCSH-APVYFYEFQHQITFLKDIRPPHVKADHGDEIPFVFG 468

  Fly   609 APFMD--TEFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYGNPTPQQVLGMHFQRAYQGEIR 671
            ..|.|  |:|            |:.::.:|...|:.:.||||:|||..:   |:.:......:.:
  Rat   469 YFFWDMKTDF------------TEEEKLLSRRMMKYWANFARHGNPNSE---GLSYWPVMDHDQQ 518

  Fly   672 YLNINTTYNSSILLNYRQTECAFWTQYLPTVI 703
            ||.::|.......|..|:.:  |||:.||..|
  Rat   519 YLQLDTQPAVGRALKARRLQ--FWTKTLPQKI 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 160/594 (27%)
LOC679149NP_001094469.1 COesterase 31..540 CDD:278561 161/601 (27%)
Aes <130..>233 CDD:223730 51/104 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C90131744
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.