DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and nlgn4xa

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:XP_021330915.1 Gene:nlgn4xa ZFINID:ZDB-GENE-100309-2 Length:844 Species:Danio rerio

Alignment Length:869 Identity:238/870 (27%)
Similarity:361/870 (41%) Gaps:228/870 (26%)


  Fly   137 VTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRG 201
            ||||||:::|.|     .|.|           :.::|....:||||||||||.|.||:||.....
Zfish    45 VTTNYGKLRGLK-----TPLP-----------NEILGPVEQYLGIPYALPPTGERRFQPPEPPMS 93

  Fly   202 WQ-LLQAVDFGPACPQ------------PVRYTG----ATKGIMDMDEDCLYLNVYSPKTGAGVA 249
            |. :..|..|.|.|||            ||.:|.    ....:.|..|||||||:|.|....| |
Zfish    94 WPGIRNATQFAPVCPQFLEDRFLLNDMLPVWFTANLDTVVTYVQDQSEDCLYLNIYVPTEDVG-A 157

  Fly   250 QK---------------------YPVMVYIHGGEFIRGASNLFQGHILASFYDVVVVTLNYRLGA 293
            .|                     .|||||||||.::.|..|:..|.||||:.:|:|||||||||.
Zfish   158 NKGDDFTNNEGGENKDIHDENGLRPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVVTLNYRLGV 222

  Fly   294 LGFLSTGDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNI 358
            ||||||||:.:.||||:|||..||||:.:||:.|.||...:|:||.|||.:...||.::..:.::
Zfish   223 LGFLSTGDQAAKGNYGLLDQIQALRWIKENIQAFKGDPKRVTIFGSGAGASCVSLLTLSHYSEDL 287

  Fly   359 VRRVIAQSGSALADWALIQDKYRAQNTSRVLGQLLGCSIESSWKLVNCLRTGRSFYELGNAEFSP 423
            .::.|.|||:||:.||:   .|:....:|:|.:.:||::..|..||.||: .:::.||.....:.
Zfish   288 FQKAIIQSGTALSSWAV---NYQPAKYTRILAEKVGCNMLDSIDLVECLQ-NKNYKELIEQYITQ 348

  Fly   424 QVGSFPWGPVLDHNFTLPGDDWYEGWREKDWRFLTQTPETLIRAGKFNRNIQYMTGVTTQEAAFF 488
            ......:|||:|.: .:|.|                 |:.|:..|:| .|...|.||...|...|
Zfish   349 AKYHIAFGPVIDGD-VIPDD-----------------PQILMEQGEF-LNYDIMLGVNQGEGFKF 394

  Fly   489 V---AQNESLSPYYELDG---RFFDQKIREHV-FRYNYTLNPNGVYEAIKYIYTFWPDPNNNTII 546
            |   ..:|        ||   ..||..:.:.| ..|.|....:.:.|.||::||.|.|..|....
Zfish   395 VDGIVDSE--------DGVSANDFDFAVSDFVDHLYGYPEGKDTLRETIKFMYTDWADKENPETR 451

  Fly   547 RDQYINMLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEALNLPQWRKYPHDIERYFLTGAPF 611
            |...:.:.:|..:.||......|..:...|.|.|......::...|.|....|..|..::.|.|.
Zfish   452 RKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWSDSAHGDEVPYVFGIPM 516

  Fly   612 M-DTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYGN---PTPQQVLGMHFQRAYQGEIRY 672
            : .|:.|       ...::.||..:|...|..:||||:.|:   |.||....:|.:.....|:.:
Zfish   517 LGPTDLF-------NCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAW 574

  Fly   673 LNINTTYNSSILL------------NYRQTECAFWTQYLPTVIGV-------------------- 705
                :.||....|            :||.|:.|||.:.:|.:..:                    
Zfish   575 ----SKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNINELFQYVSTTTKIPPQDTTP 635

  Fly   706 ------LVPTYPPTTEYWWEPKEP---------------------------------LQIAFWSM 731
                  |..|:|.||.:   |..|                                 |.:.. ::
Zfish   636 FPYTKRLGKTWPSTTRH---PGVPPANTKQTTDQRKGNDLSDDSAVVIETKRDYSTELSVTI-AV 696

  Fly   732 SVACFFLIVLVVICCIMWRNAKRQSDRFYDEDVFINGEGLEPEQDT-------RGVDNAHMVT-- 787
            ..:..||.:| ....:.::..||:.:.        |..|..|::::       ...|.||:.:  
Zfish   697 GASLLFLNIL-AFAALYYKKDKRRHES--------NRRGPSPQRNSAPANVVANANDIAHLQSDE 752

  Fly   788 --------------NHH---ALRSRDNIYEYRDSPSTKTLASKAHTDTTSLRSPSSLAMTQKS-S 834
                          :||   :|::.|.:  ....|:..||..:...|...|.:||::.|...: :
Zfish   753 LMSLQMKQQQMEHEHHHECDSLQAHDTL--RLTCPADYTLTLRRSPDDIPLMTPSTITMIPNTLA 815

  Fly   835 SQASLKS----GISLKETN---GH 851
            ...:|.:    |.|...||   ||
Zfish   816 GMQTLHNFNTFGGSQNSTNLPHGH 839

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 198/619 (32%)
nlgn4xaXP_021330915.1 COesterase 43..605 CDD:306613 198/619 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 1 1.000 FOG0000341
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43903
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.