DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and nlgn2a

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:XP_009301340.1 Gene:nlgn2a ZFINID:ZDB-GENE-090918-2 Length:828 Species:Danio rerio

Alignment Length:813 Identity:233/814 (29%)
Similarity:350/814 (43%) Gaps:189/814 (23%)


  Fly   137 VTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRG 201
            ||||||:::|.|..:.                :.::|....:||:|||..|..:.||:||.....
Zfish    49 VTTNYGKLRGIKKELN----------------NEILGPVEQYLGVPYATAPIGDRRFQPPEAPGS 97

  Fly   202 WQ-LLQAVDFGPACPQ-----------PVRYTG----ATKGIMDMDEDCLYLNVYSPKTGAGVAQ 250
            || :..|..|.|.|||           ||.:|.    |...|.:..|||||||||.|.....:.:
Zfish    98 WQEVRNATQFAPVCPQNVHGVLPEIMLPVWFTDSLDVAATYIQNQSEDCLYLNVYVPTEDGPLTK 162

  Fly   251 KY-------------------PVMVYIHGGEFIRGASNLFQGHILASFYDVVVVTLNYRLGALGF 296
            |:                   |||::||||.::.|..|:|...:||::.:|:|||:|||||.|||
Zfish   163 KHDESTLNRPRDEDIRDRRKKPVMLFIHGGSYMEGTGNMFDASVLAAYGNVIVVTMNYRLGVLGF 227

  Fly   297 LSTGDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNIVRR 361
            |||||:::.||||:|||..||||:.:||..|.||...||:||.|||.:...||:::..:..:.:|
Zfish   228 LSTGDQSAKGNYGLLDQIQALRWLNENIGHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQR 292

  Fly   362 VIAQSGSALADWALIQDKYRAQNTSRVLGQLLGCSIESSWKLVNCLRTGRSFYELGNAEFSPQVG 426
            .|||||||::.|::   .|:....:::|.:.:||:...:..||:|||. ::|.||.:.:..|...
Zfish   293 AIAQSGSAISSWSI---SYQPLKYTKILARKVGCTYGETADLVDCLRR-KNFRELVDQDIQPARY 353

  Fly   427 SFPWGPVLDHNFTLPGDDWYEGWREKDWRFLTQTPETLIRAGKFNRNIQYMTGVTTQEAAFFV-- 489
            ...:|||:|.: .:|.|                 ||.|::.|:| .|...:.||...|...||  
Zfish   354 HIAFGPVMDGD-VVPDD-----------------PEILMQQGEF-LNYDLLIGVNQGEGLKFVDD 399

  Fly   490 ---AQNESLSPYYELDGRFFDQKIREHVFR-YNYTLNPNGVYEAIKYIYTFWPDPNNNTIIRDQY 550
               ...|.:|      ...||..|...|.. |.|....:.:.|.||::||.|.|.:|..:.|...
Zfish   400 GGTESEEGIS------AAAFDYTISNFVDNLYGYPKGKDILRETIKFMYTDWADRDNGEMRRKTL 458

  Fly   551 INMLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEALNLPQWRKYPHDIERYFLTGAPFMD-T 614
            :.:.:|..:.||.....||..:.:.|||.|......:....|:|....|..|..::.|.|.:. |
Zfish   459 LALFTDHQWVAPAIATAKLHADYQSPVYFYTFYHHCQTETRPEWADAAHGDEIPYVFGVPMIGAT 523

  Fly   615 EFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYGN---PTPQQVLGMHFQRAYQGEIRYLNIN 676
            :.||..       ::.||..:|...|..:||||:.|:   |.||....:|.:.....|:    |.
Zfish   524 DLFPCN-------FSKNDIMLSAVVMTYWTNFAKTGDPNLPVPQDTKFIHTKPNRFEEV----IW 577

  Fly   677 TTYNSS------------ILLNYRQTECAFWTQYLP-------TVIGVLVPTYPP---TTEYW-- 717
            |.:||.            |..|||..:.|||.:.:|       .|........||   .|.:|  
Zfish   578 TKFNSKDKQYLHIGLKPRIRDNYRANKVAFWLELVPHLHNLHEEVFSTATTRLPPGTARTPHWKG 642

  Fly   718 ----------------WEPKEPLQIAF-------------WSMSVA----CFFLIVLVVICCIMW 749
                            .:|....|..|             .|::||    ..||.:| ....:.:
Zfish   643 QGPRTTRHPIPTFPSELDPDSSEQPRFPPFPSDTRDYSTELSVTVAVGASLLFLNIL-AFAALYY 706

  Fly   750 RNAKRQSDRFYDEDVFINGEGLEPEQDTRGVDNAHMVTN--------------HH---ALRSRDN 797
            :..||...|.:         .|.|::.....|.||....              ||   .||..|.
Zfish   707 KRDKRHEMRRH---------RLSPQRGVAANDLAHSQEEEIMSLQMKHSEHDAHHDMEPLRPHDI 762

  Fly   798 IYEYRDS-PSTKTLASKAHTDTTSLRSPSSLAM 829
            :   |.: |...|||.:...|...|.:|:::.|
Zfish   763 L---RPACPPDYTLALRRAPDDVPLMTPNTITM 792

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 195/615 (32%)
nlgn2aXP_009301340.1 COesterase 47..608 CDD:306613 195/615 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 1 1.000 FOG0000341
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43903
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.