DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and NLGN3

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_851820.1 Gene:NLGN3 HGNCID:14289 Length:848 Species:Homo sapiens

Alignment Length:840 Identity:236/841 (28%)
Similarity:341/841 (41%) Gaps:209/841 (25%)


  Fly   137 VTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRG 201
            |.|::|:::|.:|     |.|           ..::|....:||:|||.||..|.||.||.....
Human    44 VNTHFGKLRGARV-----PLP-----------SEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPS 92

  Fly   202 WQ-LLQAVDFGPACPQ-----------PVRYTG-----ATKGIMDMDEDCLYLNVYSP------- 242
            |. :..|..|.|.|||           ||.:|.     ||. |.:.:|||||||||.|       
Human    93 WSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATY-IQEPNEDCLYLNVYVPTEDVKRI 156

  Fly   243 --------------KTGAGVAQK--------------------YPVMVYIHGGEFIRGASNLFQG 273
                          |.|:|..::                    .|||||||||.::.|..|:..|
Human   157 SKECARKPNKKICRKGGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDG 221

  Fly   274 HILASFYDVVVVTLNYRLGALGFLSTGDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFG 338
            .||||:.:|:|:|||||:|.||||||||:.:.||||:|||..|||||.:||.||.||...||:||
Human   222 SILASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFG 286

  Fly   339 PGAGGASAGLLMVAPQTRNIVRRVIAQSGSALADWALIQDKYRAQNTSRVLGQLLGCSIESSWKL 403
            .|.|.:...||.::..:..:.:|.|.||||||:.||:   .|:....:.:|...:||::..:..:
Human   287 SGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWAV---NYQPVKYTSLLADKVGCNVLDTVDM 348

  Fly   404 VNCLRTGRSFYELGNAEFSPQVGSFPWGPVLDHNFTLPGDDWYEGWREKDWRFLTQTPETLIRAG 468
            |:|||. :|..||...:..|......:|||:|.: .:|.|                 ||.|:..|
Human   349 VDCLRQ-KSAKELVEQDIQPARYHVAFGPVIDGD-VIPDD-----------------PEILMEQG 394

  Fly   469 KFNRNIQYMTGVTTQEAAFFVAQNESLSPYYELDGRFFDQKIREHVFR-YNYTLNPNGVYEAIKY 532
            :| .|...|.||...|...||  ...:.|...:.|..||..:...|.. |.|....:.:.|.||:
Human   395 EF-LNYDIMLGVNQGEGLKFV--EGVVDPEDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKF 456

  Fly   533 IYTFWPDPNNNTIIRDQYINMLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEALNLPQWRKY 597
            :||.|.|.:|....|...:.:.:|..:..|......|......|.|.|......::|..|.|...
Human   457 MYTDWADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDA 521

  Fly   598 PHDIERYFLTGAPFM-DTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYGN---PTPQQVL 658
            .|..|..::.|.|.: .|:.||..       ::.||..:|...|..:||||:.|:   |.||...
Human   522 AHGDEVPYVFGVPMVGPTDLFPCN-------FSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTK 579

  Fly   659 GMHFQRAYQGEIR----------YLNINTTYNSSILLNYRQTECAFWTQYLP-----------TV 702
            .:|.:.....|:.          ||:|.  ....:..:||.|:.|||...:|           |.
Human   580 FIHTKANRFEEVAWSKYNPRDQLYLHIG--LKPRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTS 642

  Fly   703 IGVLVPTYPPTTEY-----------WWEPKEP-LQIAF--------W------------------ 729
            ....||  ||.|.:           .|..|.| :..|:        |                  
Human   643 TTTKVP--PPDTTHSSHITRRPNGKTWSTKRPAISPAYSNENAQGSWNGDQDAGPLLVENPRDYS 705

  Fly   730 ---SMSVA----CFFLIVLVVICCIMWRNAKRQSDRFYDEDVFINGE----GLEPEQDTRGVDNA 783
               |:::|    ..||.|| ....:.:|..||:.:............    |..||::...:   
Human   706 TELSVTIAVGASLLFLNVL-AFAALYYRKDKRRQEPLRQPSPQRGAGAPELGAAPEEELAAL--- 766

  Fly   784 HMVTNHHALRSRDNIYEYRDSPSTKTLASKAHTDTT----------SLRSPSSLAMTQKS 833
            .:...||         |....|...||...|..|.|          .|.:|:::.|...|
Human   767 QLGPTHH---------ECEAGPPHDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNS 817

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 198/631 (31%)
NLGN3NP_851820.1 COesterase 36..624 CDD:278561 198/631 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 1 1.000 FOG0000341
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43903
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.