DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and Ces2h

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:XP_008770745.1 Gene:Ces2h RGDID:1560889 Length:570 Species:Rattus norvegicus

Alignment Length:618 Identity:180/619 (29%)
Similarity:271/619 (44%) Gaps:98/619 (16%)


  Fly   124 QRRDSLTLERDVFVTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPT 188
            |.:|||:..|    ||:.||:.|..::|      |......||           |||||:|.||.
  Rat    24 QGQDSLSPIR----TTHTGQILGSLIHM------KGLDVGVHS-----------FLGIPFAKPPI 67

  Fly   189 FEGRFKPPRVHRGWQLLQAVDFGPA-CPQPV--------RYTGATKGIMDMDEDCLYLNVYSPKT 244
            ...||.||.....|..::.....|| |.|.:        :....|..::.|.|||||||:|:| .
  Rat    68 GPLRFAPPEAPEPWSGVRDGTSHPAMCLQDITAMNMQAFKLLKLTLPLIPMSEDCLYLNIYTP-N 131

  Fly   245 GAGVAQKYPVMVYIHGGEFIRGASNLFQGHILASFYDVVVVTLNYRLGALGFLSTGDENSPGNYG 309
            .|......||||:||||..:.|.::|:.|.:||:..:|||||:.||||.|||.||||:::.||:|
  Rat   132 HAHEGSNLPVMVWIHGGALVIGMASLYDGSMLAAMENVVVVTIQYRLGVLGFFSTGDQHARGNWG 196

  Fly   310 ILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNIVRRVIAQSGSALADWA 374
            .|||..||.||..||..|.|:.:.:|:||..|||.|....:|:|.:|.:....|.:||.||.. :
  Rat   197 YLDQVAALHWVQQNIAHFGGNPDRVTIFGESAGGTSVSSHVVSPMSRGLFHGAIMESGVALMS-S 260

  Fly   375 LIQDKYRAQNTSRVLGQLLGCSIESSWKLVNCLRTGRSFYELGNAEFSPQVGSFPWGPVLDHNFT 439
            ||  ...:....|.:..|.||....|..|||||| |:|..|:.:...:.::.|   |.|      
  Rat   261 LI--SVSSDVVYRTVANLSGCEQVDSKALVNCLR-GKSEEEIMSINKAFRIIS---GIV------ 313

  Fly   440 LPGDDWYEGWREKDWRFLTQTPETLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESLSPYYELDGR 504
                         |..||.:.|:.|:.:..|: .|..:.||...|..:.:..:.:.:...:...|
  Rat   314 -------------DGIFLPRHPKELLASADFH-PIPSIIGVNNDEYGWIIPSSMTTTDSKKKMDR 364

  Fly   505 FFDQKIREHVFRYNYTLNPNGVYEAIKYIYTFWP-------------DPNNNTIIRDQYINMLSD 556
            ...|.|.:.                 :.....||             |..:...::.|:..|:.|
  Rat   365 QMVQAILQK-----------------RVAQMMWPPEFSDLLLEEYMGDSEDPQFLQVQFKEMMED 412

  Fly   557 LYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEAL--NLPQWRKYPHDIERYFLTGAPFMDTEFFPK 619
            ..:..|..|:.... ....|||.|.........  :.|...|..|..|..|:..:.:..|:..|.
  Rat   413 FTFVIPALQVAHFQ-RSNAPVYFYEFQHRPSFFKDSKPPHVKADHGDEILFIFRSFWGGTQAIPS 476

  Fly   620 KE-HLQRNM-WTDNDRNMSHFFMQTYTNFARYGNPTPQQVLGMHFQRAYQGEIRYLNINTTYNSS 682
            .| |..|:: .|:.:..:|...|:.:.||||.|||..:   |:.:...:..:.:||.::|.....
  Rat   477 CESHGIRHVDLTEEEELLSRRMMKYWANFARQGNPNSE---GLPYWPVFDHDEQYLQLDTQPAVG 538

  Fly   683 ILLNYRQTECAFWTQYLPTVIGVLVPTYPPTTE 715
            ..|..::.:  |||:.||..|..|..|....||
  Rat   539 RALKAKRLQ--FWTKTLPEKIRELKDTEDRHTE 569

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 166/587 (28%)
Ces2hXP_008770745.1 COesterase 30..549 CDD:278561 167/591 (28%)
Aes <127..>230 CDD:223730 51/104 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89573698
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.