DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and CG4757

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001262469.1 Gene:CG4757 FlyBaseID:FBgn0027584 Length:550 Species:Drosophila melanogaster

Alignment Length:639 Identity:170/640 (27%)
Similarity:254/640 (40%) Gaps:179/640 (28%)


  Fly   129 LTLERDVFVTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRF 193
            |::|    |.|..|:|:|..:                  ..|:......|.||.||.||..:.||
  Fly    19 LSIE----VDTELGRVRGANL------------------TSRLGVNFHAFRGIRYAEPPLGDLRF 61

  Fly   194 KPPRVHRGW--QLLQAVDFGPACPQPVRYTGATKGIMDMDEDCLYLNVYSPKTGAGVAQKYPVMV 256
            ..|:..:.|  ::..|.:.||.||||      ...:.|:.||||.||||:    ..:..:.||:|
  Fly    62 VNPQPVKPWSPKIFDASEDGPMCPQP------WDNMTDVSEDCLRLNVYT----KDLKGRRPVIV 116

  Fly   257 YIHGGEF--IRGASNLFQG--HILASFYDVVVVTLNYRLGALGFLSTGDENSPGNYGILDQAMAL 317
            ::|.|.|  ..|.|....|  |.:..  |.|:|:||||||:||||:||.:.:|||.|:.||.:||
  Fly   117 FLHPGGFYVFSGQSKYLAGPEHFMDR--DCVLVSLNYRLGSLGFLATGSKEAPGNAGLKDQVLAL 179

  Fly   318 RWVYDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNIVRRVIAQSGSALADWALIQDKYR- 381
            ||:..:|:.|.||.:|:||.|..||..|..|.|::|.:|.:..|.|..|.   |.:..:  ||: 
  Fly   180 RWIQQHIQRFGGDPDSVTLLGYSAGSISVALHMLSPMSRGLFHRGICMSA---APYGPV--KYKD 239

  Fly   382 --AQNTSRVLGQLLGCSIESSWKLVNCLR---------TGRSFYELGNAEFSPQVGSFPWGPVLD 435
              .|...|..| ||.|..||..::|.|:|         |....:|.|            |.|||:
  Fly   240 NDLQLAKRQAG-LLKCPQESIGEMVECMRRKPYLDYVSTYNGMFEFG------------WNPVLN 291

  Fly   436 HNFTLPGDDWYEGWR---EKDW---RFLTQTPETLIRAGKFNRNIQYMTGVTTQE---AAFFVAQ 491
                         ||   |||:   |:|.::|....|.|.|:: :..:||:|..|   .|||..:
  Fly   292 -------------WRIVVEKDFGQERYLIESPFKTARRGDFHK-VALITGITEFEFLSGAFFDLR 342

  Fly   492 NESLSPYYELDGRFFDQKIREHVFRYNYTLNPNGVYEAIKYIYTFWPDPNNNTIIRDQYI----- 551
            |||:...|..|.        ||.......|..|.......           :.:.|::|:     
  Fly   343 NESIVNRYNRDW--------EHYASIALLLEQNSTQSRAA-----------SRVFREKYMPESLD 388

  Fly   552 ------------NMLSDLYYRAPVDQMVKLMLEQKVPVYMYVL--------------NTTVEALN 590
                        .:|||........:.::|| ....|:|.|:.              ..|:..::
  Fly   389 KLEYPKSLKGMGELLSDALIGVSFHRFLQLM-SPHTPIYTYLFRYKGRYTFLKNPDNQQTIGPVH 452

  Fly   591 LPQWRKYPHDIERY-FLTG--APFMDTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYGNP 652
                    ||...| |..|  .|.:..|              |.:..|.....:.:..||:.|:|
  Fly   453 --------HDELIYLFHVGLLIPLLKRE--------------DPENFMIELLTRMWIEFAQKGDP 495

  Fly   653 ---TPQQVLGMHFQRAYQGEIRYLNIN---TTYNSSILLNYRQTECAFWTQYLP 700
               ..:.:.|:::......:..||.|.   |..:....||..|    .|....|
  Fly   496 HNKNDEYLKGLNWPLYNAQDKGYLEIGNNLTAKSGGFFLNRYQ----IWEDLFP 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 166/628 (26%)
CG4757NP_001262469.1 COesterase 15..540 CDD:278561 168/633 (27%)
Aes 40..>204 CDD:223730 71/176 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89376648
eggNOG 1 0.900 E1_COG2272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.