DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and Nlg3

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001036685.2 Gene:Nlg3 FlyBaseID:FBgn0083963 Length:1159 Species:Drosophila melanogaster

Alignment Length:1027 Identity:249/1028 (24%)
Similarity:365/1028 (36%) Gaps:291/1028 (28%)


  Fly   137 VTTNYGQVQGFKVYMYD-NPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHR 200
            :.|..|.:.|..|.:.. :.||...||                 |||||.||....||.||....
  Fly   158 INTRNGAISGVIVQLDGRHLDPVEAYR-----------------GIPYASPPVGNLRFMPPVSAA 205

  Fly   201 GWQLLQAVD-FGPACPQPV----RYTGA----TKG-----------IMDMDEDCLYLNVYSP--- 242
            .|..::..| |.|.|||.:    ..|.|    .||           :.:..|||||||:|.|   
  Fly   206 MWSGVKKADRFSPVCPQRLPDIHNETAALERMPKGRLEYLKRLLPYLQNQSEDCLYLNIYVPIQV 270

  Fly   243 ------------------------------------KTGAGVAQKYPVMVYIHGGEFIRGASNLF 271
                                                ..|:|...||||:|::||..:...:.|.:
  Fly   271 GSRDSSGSSSSSSAGSSSSGSGGSSSSSSSSSTSSSSAGSGSPAKYPVLVFVHGESYEWNSGNPY 335

  Fly   272 QGHILASFYDVVVVTLNYRLGALGFLSTGDE---NSPGNYGILDQAMALRWVYDNIEFFNGDRNS 333
            .|.:|||:..::|||:|||||.||||:...:   ..|.|||::|...||.|:.:||..|.||.||
  Fly   336 DGSVLASYGQILVVTINYRLGVLGFLNANTDRYSKLPANYGLMDIIAALHWLKENIAAFGGDPNS 400

  Fly   334 ITLFGPGAGGASAGLL---MVAPQTRNIVRRVIAQSGSALADWALIQD--KYRAQNTSRVLGQLL 393
            |||.|.|.|.|....|   |..|:.. :..|.|..|||.||.|:|:.:  ||.|     ::...:
  Fly   401 ITLAGHGTGAACVHFLISSMAVPEGL-LFNRAILMSGSGLAPWSLVSNPAKYAA-----IVAHHV 459

  Fly   394 GCSIE-SSWKLVNCLRTGRSFYELGNAEFSPQVGSFPWGPVLDHNFTLPGDDWYE---------- 447
            .|:.: ....|:.|||. ::..:|.:....|....|.:||.:| ...:.|.|:..          
  Fly   460 NCASDLPHAHLMKCLRE-KTLDQLLSVPIRPPEFGFAFGPSID-GVVIDGGDYVPPAPGSPAAQA 522

  Fly   448 ----------------------GWREKDWRFLTQTPE-----TLIRAGKFNRNIQY--MTGVTTQ 483
                                  ||         .||.     .|:|....|:..:|  |.|||..
  Fly   523 QAQASTAAGNGLGGEAGIAAAGGW---------GTPGQLENIVLMRKTAINKLSRYDLMAGVTRA 578

  Fly   484 EAAFFVAQNESLSPYYELDGRFFDQKIREHVFRYNYTLNPNGVYEAIKYIYTFWPDPNNNTI-IR 547
            | |||...:..:....|.|.|   .:|.:...|..||.:.|.::..|...||.|..|..:.| ||
  Fly   579 E-AFFSFNSGDVQYGIEADRR---SRILKAYVRNTYTFHLNEIFATIVNEYTDWERPVQHPINIR 639

  Fly   548 DQYINMLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEALNLPQWRKYPHDIERYFLTGAPFM 612
            |:.:..|||....||..|.|.|........|:||.:......:.||.:...|..:..::.|||.:
  Fly   640 DETLEALSDAQVVAPAAQTVDLHSADHRNSYLYVFDYQTRFGDYPQRQGCIHGEDLPYIFGAPLV 704

  Fly   613 DTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYGNPTPQQVL--GMHFQR---------AY 666
            .     ...|..|| :|..:.::|...|..::||.|.|||..|...  |...:|         ||
  Fly   705 G-----GFNHFTRN-YTKTEISLSEVVMFYWSNFVRTGNPNEQMETEHGSRQERSRYKTIEWTAY 763

  Fly   667 QG-EIRYLNINTTYNSSILLNYRQTECAFWTQYLPTVI---GVLVP--------------TYPPT 713
            :. ..:|||.:|  ...:..:||....:||...:|.:.   |..||              ..|..
  Fly   764 ESVHKKYLNFDT--KPKLKNHYRAHRLSFWLNLIPDLHKPGGDNVPAAHHQLHDDDDEDNNIPSD 826

  Fly   714 TEYWWEPKEPLQIA----------FWSMSVACFFLIVLVVICCIMWRNAKRQ-SDRFYDEDVFIN 767
            ...  :|..|..|:          |...:...|.|:.|......:.||..|. ..:.|.:|:...
  Fly   827 ASV--KPLNPPYISRAANAAAMANFTIFTNQVFSLLNLSSPSSSLQRNGTRYGGGKIYPDDMMDG 889

  Fly   768 ---GEGLEPEQDTRG-------------------VDNAHMVTNHHALRSRDNIYEYRDSPSTK-- 808
               |......||:.|                   :.|..:....:..|.:..:.|.|  |.||  
  Fly   890 DHAGGAASASQDSDGFAAYSTALSVTIAIGCSLLILNVLIFAGVYYQRDKTRLSEPR--PQTKLK 952

  Fly   809 ----------------TLASKAHTDTTSLRS-------------------------PSSLAMTQK 832
                            ||...|.:|..::.|                         |..:...|.
  Fly   953 RQENGQMPNNICGDLETLTIHAKSDPATILSHHHAMQHHQLPPPEFADIPHRAPPPPKHMKSLQD 1017

  Fly   833 SSSQASLKSGISLK---------------ETNGHLVKQSERAATPRSQQNGSTAKVASPPVEEKR 882
            .....|:...:.:.               ...|.|.|:|      ..:|..:.|:..||..::::
  Fly  1018 PGGGGSVSGAVGVSGVVQMPPPHALQVMGNQCGTLTKKS------CMKQTQAQAQQHSPAQQQQQ 1076

  Fly   883 LLQPLSSTPVT---QLQAEPAKRVPTAASVSGSSRSTTP--VP-SARSTTTH 928
            ..|......||   .||....:.:.|..:.:|.....||  || ...|||.|
  Fly  1077 QQQQQQQHVVTHQQHLQNHHNQSMTTVLTTAGGLVVPTPPTVPVIVASTTQH 1128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 189/679 (28%)
Nlg3NP_001036685.2 COesterase 151..791 CDD:278561 189/679 (28%)
Aes <313..>410 CDD:223730 45/97 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C90394654
eggNOG 1 0.900 E1_COG2272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 1 1.000 FOG0000341
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43903
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.