DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and alpha-Est2

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001262345.1 Gene:alpha-Est2 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster

Alignment Length:676 Identity:180/677 (27%)
Similarity:270/677 (40%) Gaps:204/677 (30%)


  Fly   112 VLAGWRE------DLQG-KQRRDSLTLERDVFVTTNYGQVQGF-KVYMYDNPDPKSFYRPYHSTV 168
            |..||.:      .|.| |.::..|:....|.:.|.||||:|. :..:||.       .||.:  
  Fly     3 VQVGWPKLIKMGAQLVGHKVQQYRLSTGHTVILDTKYGQVRGLQRKTVYDK-------EPYFA-- 58

  Fly   169 DRVMGECSVFLGIPYALPPTFEGRFKPPRVHRGWQ-LLQAVDFGPACPQPVRYTGATK------- 225
                     |.|||||.||..:.||:.|:....|| :|...            |..:|       
  Fly    59 ---------FEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCT------------TNRSKPMQRNML 102

  Fly   226 -GIMDMDEDCLYLNVYSPKTGAGVAQK-YPVMVYIHGGEFIRGASNLFQGHILASFY----DVVV 284
             ||::..||||:||||   ..|..::| .||:|:|:||.|.:|.::   ..|.:..|    .||.
  Fly   103 LGIVEGSEDCLHLNVY---VKALKSEKPLPVIVWIYGGGFQKGEAS---RDIYSPDYFMKKPVVF 161

  Fly   285 VTLNYRLGALGFLSTGDE--NSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAG 347
            |.:||||.||||||..|.  :.|||.|:.||.|||||:..||..||||.|:|||.|..||.||..
  Fly   162 VAINYRLAALGFLSLKDPKLDVPGNAGLKDQVMALRWISQNIAHFNGDPNNITLMGESAGSASVH 226

  Fly   348 LLMVAPQTRNIVRRVIAQSGSALADWALIQDK---YR-AQN---------------TSRVLGQLL 393
            ::|...|||.:..:.|.|||.||::|....|.   :| |||               .|:|..:.:
  Fly   227 VMMTTEQTRGLFHKAIMQSGCALSEWVESPDNNWAFRLAQNLGYKGDEKDADVLSFLSKVCARQI 291

  Fly   394 GCSIESSWKLVNCLRTGRSFYELGNAEFSPQVGSFPWGPVLDHNFTLPGDDWYEGWREKDWRFLT 458
             .:|:..  ::| |...|||.            .|.:|||::...|   |......|.||     
  Fly   292 -AAIDQD--VIN-LDEVRSFL------------LFAFGPVIEPYET---DHCVVPKRHKD----- 332

  Fly   459 QTPETLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESLSPYYELDGRFFDQKIREHVFRYNYTLNP 523
                  :.:..:..:|..:.|..:                  .:|.|..|.:|:..:        
  Fly   333 ------LLSEAWGNDIPVIVGGNS------------------FEGLFSYQLVRKDPW-------- 365

  Fly   524 NGVYEAIKYIYTFWPDPNNNTII---RDQYINMLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTT 585
                 |:|..:...|.....|..   :|..:..|..||:...:.:.:::.               
  Fly   366 -----ALKNFHNILPREVRETSSLEGQDLLVRRLKQLYFNNEMQESMEMF--------------- 410

  Fly   586 VEALNLPQWRKYPHDIERYFL---TGAPFMDTEFF------PKKEHLQRNMWTDNDRNMSH---- 637
             ||||:...|:..||..|:.|   :.||...|..:      |.....:|.:..|..|.::|    
  Fly   411 -EALNIFSHRQIWHDTHRFILARQSYAPKTPTYLYRFDFDSPHFNQFRRLVCGDRIRGVAHADEL 474

  Fly   638 ---FF--------------------MQTYTNFARYGNPT-PQQVLGMHFQRAYQGEIRYLNINTT 678
               |:                    :..:|:||..|||. |:  ||.....|.|  ::...:...
  Fly   475 SYLFYNIIASKLDKSSMEYKTIERMVGMWTSFASSGNPNCPE--LGSAKWEAVQ--LKENAVEKC 535

  Fly   679 YNSSILLNYR---QTEC-AFWTQYLP 700
            :|.|..|..|   :::| |.|..:.|
  Fly   536 FNISHDLEMRDLPESDCLAVWDTFYP 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 171/641 (27%)
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 163/606 (27%)
Aes <117..>221 CDD:223730 51/110 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89377162
eggNOG 1 0.900 E1_COG2272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.