DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and alpha-Est8

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_524259.2 Gene:alpha-Est8 FlyBaseID:FBgn0015576 Length:574 Species:Drosophila melanogaster

Alignment Length:610 Identity:159/611 (26%)
Similarity:241/611 (39%) Gaps:177/611 (29%)


  Fly   123 KQRRDSLTLERDVFVTTNYGQVQGFKVYMYDNPDPKSFY-RPYHSTVDRVMGECSVFLGIPYALP 186
            |..:..|.....|...|.||:|:|.|.        :|.| ..|:|           |.|||:|.|
  Fly    21 KTNQQRLRSNDKVIADTVYGKVKGVKW--------QSIYGNNYYS-----------FEGIPFAKP 66

  Fly   187 PTFEGRFKPPRVHRGWQLLQAVDFGPACPQPVRYTGATKGIMDMDEDCLYLNVYSPKTGAGVAQK 251
            |..|.|||.|.....|..::......|  :|.:.....|.:.. .|||||||||:.:...  .:.
  Fly    67 PVGELRFKAPVEPEHWSDVKRCTHVRA--KPCQVNIVLKQVQG-SEDCLYLNVYTRELHP--HRP 126

  Fly   252 YPVMVYIHGGEFIRG--ASNLFQGHILASFYDVVVVTLNYRLGALGFLSTGDE--NSPGNYGILD 312
            .||:|:|:||.|..|  :.:|:....:...: ||:|.::||||||||||..||  :.|||.|:.|
  Fly   127 LPVLVWIYGGGFQMGEASRDLYSPDYIMMEH-VVLVVISYRLGALGFLSLADEELDVPGNAGLKD 190

  Fly   313 QAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNIVRRVIAQSGSALADWAL-- 375
            |.||||||..|.:||.||.::||:||..|||||...:|:..|.:.:..:.|..||||||.||.  
  Fly   191 QVMALRWVKRNCQFFGGDPDNITVFGESAGGASTHYMMLTDQAKGLFHKTIIMSGSALAPWAQTP 255

  Fly   376 --IQDKYR-AQ--------NTSRVLGQLLGCSIESSWKLVNCLRTGRSFYELGNAEFSPQVGSFP 429
              |...|| ||        |...:...|..|...|..|:...:.|....::        ::..|.
  Fly   256 THINWPYRLAQATGYTGDANDRDIFAHLKKCKASSMLKVAEDIITMEERHQ--------RLTMFS 312

  Fly   430 WGPVLDHNFT--------------------LP---GDDWYEGW----REKDWRFLTQTPETLIRA 467
            :||.::...|                    :|   |.:.:||.    ....|      ||.|.:.
  Fly   313 FGPTIEPYLTPHCVIPKSPLEMMRDCWGNSIPMVIGGNSFEGLLMFPEVNKW------PELLCQL 371

  Fly   468 GKFNRNIQYMTGVTTQEAAFFVAQNESLSP----YYELDGRFFDQKIRE---------------- 512
            |                      ..|:|:|    ..|...:.|.:|:||                
  Fly   372 G----------------------DCENLAPQDAHVDEQQRKAFGKKVRELYFGDRTPGRKTILEY 414

  Fly   513 -HVFRYNYTLNPNGVYEAI-----------KYIYTFWPDPNNNTIIR----------DQYINMLS 555
             .:|.|.|..  :|::..:           .::|.|..|..:..|:|          ..:.:.||
  Fly   415 SDLFSYKYFW--HGIHRTLLSRAHHAPLAPTFLYRFDFDSKHFNIMRIITCGRKVRGTCHADDLS 477

  Fly   556 DLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEALNLPQWRKYPHDIERYFLTGAPFMDTEFFPKK 620
            .|:|.|...::.:...|.|          |::.|        ...:..:.::|.|.:......:|
  Fly   478 YLFYNAAAKKLKRRTAEFK----------TIKRL--------VSMVVHFAISGDPNIPMVCQDEK 524

  Fly   621 EHLQRNMW---TDNDR-----NMSH 637
            |. .|..|   :.:|:     |:||
  Fly   525 EQ-PRGAWLPISKDDKVFQCLNISH 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 157/600 (26%)
alpha-Est8NP_524259.2 COesterase 29..564 CDD:278561 157/603 (26%)
Aes <116..>221 CDD:223730 49/108 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89376727
eggNOG 1 0.900 E1_COG2272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.