DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and CG9289

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_609245.1 Gene:CG9289 FlyBaseID:FBgn0032058 Length:674 Species:Drosophila melanogaster

Alignment Length:661 Identity:169/662 (26%)
Similarity:254/662 (38%) Gaps:154/662 (23%)


  Fly    83 PGQYPQGMPNEDRFRFDPNDPNARTQFPGVLAGWREDLQGKQRRDSLTLERDVFVTT--NYGQVQ 145
            ||....|:....|    |.....:.|.|....|     |..|       |..||.||  :.|:::
  Fly    39 PGNQNFGIQKNKR----PKPQKVQKQKPNKQQG-----QNGQ-------EPKVFTTTVPDLGRLR 87

  Fly   146 GFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRGWQ-LLQAVD 209
            |..:                 |.|....:...||.|||....    ||:|......|: :|.|..
  Fly    88 GRTL-----------------TTDWTGQKIMQFLDIPYGKAE----RFRPAEPAPSWKGVLPAHR 131

  Fly   210 FGPACPQPVRYTGATKGIMDM------------DEDCLYLNVYSPKTGAGVAQKYPVMVYIHGGE 262
            ....||          .|.|:            .||||.|:|   .|.|...:..||||||||..
  Fly   132 PHAGCP----------SIQDLIVFAKLEEDGFDVEDCLRLSV---NTKAMEGKSLPVMVYIHGDF 183

  Fly   263 FIRGAS-NLFQGHILASFYDVVVVTLNYRLGALGFLSTGDENSPGNYGILDQAMALRWVYDNIEF 326
            |..|.| ....|::|.  :|||:|::.||||..|||||..:..|||..:.|..:||:||..:|..
  Fly   184 FYDGDSVEAAPGYLLE--HDVVLVSVRYRLGPFGFLSTLTDEMPGNAAVTDIILALKWVQQHIAS 246

  Fly   327 FNGDRNSITLFGPGAGGASAGLLMVAPQT-RNIVRRVIAQSGSALADWALIQDKYRAQNTSRVLG 390
            |.||...:||||...|.|...:|.::|.. ..:..|||.|||:||:. |.|.|  .....::.:|
  Fly   247 FGGDPQRVTLFGQVGGAALVNVLTLSPAVPAGLFHRVIYQSGTALSP-AFITD--APLGATKAIG 308

  Fly   391 QLLGCSIESSWKLVN-CLRTGRSFYELG----NAEFSPQVGSFPWGPVLDHNFTLPGDDWYEGWR 450
            ::.||...:....:| ||....:...|.    :.|..|.:....:|.|   ...:.|..      
  Fly   309 RIAGCKQSTKVDQLNKCLNRLNATMLLAAFSVHGENQPSLSGGAYGGV---QLVIGGPS------ 364

  Fly   451 EKDWRFLTQTPETLIRAGKFNRNIQYMT-GVTTQEAAFFVAQ-------NESLSPYYELDGRFFD 507
                ..|.:.|..|:.|.||.   .|.| |.:.:....|:.:       ||::     ||.....
  Fly   365 ----GILPEHPGRLLAAEKFQ---AYPTMGGSVKHGGTFMLRDIFADIFNETI-----LDDTMTG 417

  Fly   508 QKIREHVFRYNYTLNPNGVYEAI--KYIYTFWPDPNNNTIIR--DQYINMLSDLYYRAPVDQMVK 568
            ::..:.:.......:|:|.::..  :.|:| ..|..|.|..|  ...|::.|.:..:.|    |.
  Fly   418 RQYIDTIIEQANGADPSGSWKEFSDEEIFT-QNDVKNGTFKRLTPGLIDLCSTISLKNP----VL 477

  Fly   569 LMLE---QKVP--VYMYVLNTTVEALNLPQWRKYPHDIERY-----------FLTGAPFMDTE-- 615
            |:|:   :|:|  .|:|..:             |..:..||           |..|....|..  
  Fly   478 LVLQANAKKLPNSTYLYSFD-------------YEGEQNRYATGEDEANFVPFDMGVSLTDDNLY 529

  Fly   616 FFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYGNPTPQQVLGMHFQRAYQGEI-RYLNINTT- 678
            .||....|..|  ::.|..::...:..:|:||..|.|   |..|:....|...|. .|:.|:.| 
  Fly   530 LFPWPRFLALN--SNRDLKVARRMVALWTSFATTGVP---QAPGLPAWPAMNDETGPYMKIDRTV 589

  Fly   679 -YNSSILLNYR 688
             :..:.|..||
  Fly   590 SFGDNYLDEYR 600

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 158/611 (26%)
CG9289NP_609245.1 COesterase 83..600 CDD:278561 153/600 (26%)
Aes <171..351 CDD:223730 66/185 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89376764
eggNOG 1 0.900 E1_COG2272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.