DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and SPAPB18E9.04c

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001018272.1 Gene:SPAPB18E9.04c PomBaseID:SPAPB18E9.04c Length:800 Species:Schizosaccharomyces pombe

Alignment Length:313 Identity:72/314 (23%)
Similarity:107/314 (34%) Gaps:68/314 (22%)


  Fly   676 NTTYNSSILLNYRQTECAFWTQYLPTVIGV--LVPTYPPT-TEYWWEPKEPLQIA--------FW 729
            ::|..||..|....|.|...|...||....  :.||.||| |.....|..|...:        ..
pombe   323 SSTGTSSSPLPSTSTSCTTSTSIPPTGNSTTPVTPTVPPTSTSSTSTPPPPASTSSTGTSSSPLL 387

  Fly   730 SMSVACFFLIVLVVICCIMWRNAKRQSDRFYDEDVFINGEGLEPEQDT-RGVDNAHMVTNHHALR 793
            |.|.:|                       .....:...|....|...| ....::..:|..:...
pombe   388 STSTSC-----------------------TTSTSIPPTGNSTTPVTPTVPPTSSSTPLTTTNCTT 429

  Fly   794 SRDNIYEYRDSPSTKT-LASKAHTDTTSLRSPSS-LAMTQKSSSQASLKSGI----------SLK 846
            |..  ..|..:|.|.| ||:...|.:||:...|: :..|..:::..:..:.|          .|.
pombe   430 STS--VPYTSTPVTSTPLATTNCTTSTSVPYTSTPVTSTPLTTTNCTTSTSIPYTSTPVTSTPLT 492

  Fly   847 ETNGHLVKQSERAATPRSQQN---GSTAKVASPPVEEKRLL---------QPLSSTPVTQLQAEP 899
            .||..........:||.:..|   .|:..|.|.||......         .|::|||:.......
pombe   493 TTNCTTSTSVPYTSTPVTSSNYTISSSTPVTSTPVTTTNCTTSTSVLYTSTPVTSTPLATTNCTT 557

  Fly   900 AKRVP-TAASVSGSS---RSTTPVPSARSTTTHTTTAT---LSSQPAAQPRRT 945
            :..|| |:..|:.|:   .|:|||.|...|||:.||:|   .:|.|...|..|
pombe   558 STSVPYTSTPVTSSNYTISSSTPVTSTPVTTTNCTTSTSVLYTSTPITSPNST 610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 6/19 (32%)
SPAPB18E9.04cNP_001018272.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43903
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.