DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and CES4A

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:XP_011521323.1 Gene:CES4A HGNCID:26741 Length:628 Species:Homo sapiens

Alignment Length:643 Identity:172/644 (27%)
Similarity:264/644 (41%) Gaps:165/644 (26%)


  Fly   137 VTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRG 201
            |.|.||.:||.::::...|                   ..||||:|::.||....||.||.....
Human    52 VVTKYGTLQGKQMHVGKTP-------------------IQVFLGVPFSRPPLGILRFAPPEPPEP 97

  Fly   202 WQ-LLQAVDFGPA-----------------------------CPQPVRYTG-----------ATK 225
            |: :..|..:.|.                             .|||:...|           |:.
Human    98 WKGIRDATTYPPGWSLALSPGWSAVARSRLTATSASRVQASLLPQPLSIWGYRCLQESWGQLASM 162

  Fly   226 GI--------MDMDEDCLYLNVYSPKTGAGVAQKYPVMVYIHGGEFIRGASNLFQGHILASFYDV 282
            .:        :...|||||||||:|....|..| .||||:..||.||.||::.::|..||:...|
Human   163 YVSTRERYKWLRFSEDCLYLNVYAPARAPGDPQ-LPVMVWFPGGAFIVGAASSYEGSDLAAREKV 226

  Fly   283 VVVTLNYRLGALGFL----STGDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGG 343
            |:|.|.:|||..|||    .|.|.::.||:|:|||..|||||.:||..|.||..::||||..||.
Human   227 VLVFLQHRLGIFGFLRWRGRTDDSHARGNWGLLDQMAALRWVQENIAAFGGDPGNVTLFGQSAGA 291

  Fly   344 ASAGLLMVAPQTRNIVRRVIAQSGSALADWALIQDKYRAQNTSRVL------GQLLGCSIESSWK 402
            .|...||::|....:..|.|:|||:||         :|...||..|      ..|.||:..|:..
Human   292 MSISGLMMSPLASGLFHRAISQSGTAL---------FRLFITSNPLKVAKKVAHLAGCNHNSTQI 347

  Fly   403 LVNCLR--TGRS---------FYELGNAEFSPQVGSFPWGPVLDHNFTLPGDDWYEGWREKDWRF 456
            ||||||  :|..         |.:| |.:..|:...:...||:| ...:|.|             
Human   348 LVNCLRALSGTKVMRVSNKMRFLQL-NFQRDPEEIIWSMSPVVD-GVVIPDD------------- 397

  Fly   457 LTQTPETLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESLSPY---YELDGRFFDQKIREHVFRYN 518
                |..|:..||.: ::.|:.||...|..:       |.||   :.|:.:...::....:....
Human   398 ----PLVLLTQGKVS-SVPYLLGVNNLEFNW-------LLPYIMKFPLNRQAMRKETITKMLWST 450

  Fly   519 YTLNPNGVYEAIKYIYTFWPDPNNN---TIIRDQYINMLSDLYYRAPVDQMVKLMLEQKVPVYMY 580
            .|| .|...|.:..:...:.|..|.   .::|::.::::.|..:.....|......:..:|||:|
Human   451 RTL-LNITKEQVPLVVEEYLDNVNEHDWKMLRNRMMDIVQDATFVYATLQTAHYHRDAGLPVYLY 514

  Fly   581 VLNTTVEALNL-PQWRKYPHDIERYFLTGAPFMDTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYT 644
            ........:.: |:.....|..|.|||.|.||.......|::.|...|            |:.:.
Human   515 EFEHHARGIIVKPRTDGADHGDEMYFLFGGPFATGLSMGKEKALSLQM------------MKYWA 567

  Fly   645 NFARYGNPT-------PQQVLGMHFQRAYQGEIRYLNINTTYNSSILLNYRQTECAFW 695
            ||||.|||.       |:          |..:.:||.::  :.:.:.:..::.:.|||
Human   568 NFARTGNPNDGNLPCWPR----------YNKDEKYLQLD--FTTRVGMKLKEKKMAFW 613

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 171/642 (27%)
CES4AXP_011521323.1 COesterase 46..613 CDD:278561 171/642 (27%)
Aes <184..>291 CDD:223730 52/108 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.