DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and C23H4.7

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_741910.3 Gene:C23H4.7 WormBaseID:WBGene00007695 Length:617 Species:Caenorhabditis elegans

Alignment Length:710 Identity:146/711 (21%)
Similarity:242/711 (34%) Gaps:210/711 (30%)


  Fly   137 VTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRG 201
            :.|:||:|:|...:..||                  ....:|..:|:|.||..:.||.||:....
 Worm    24 IETSYGRVRGITEWSDDN------------------NHKYMFKSVPFAKPPIGKLRFAPPQYPDS 70

  Fly   202 WQ-LLQAVDFGPACPQPVRYTGATKGIMDMDEDCLYLNVYSPKTGAGVAQKYPVMVYIHGGEFIR 265
            |. :|.|..:.|||......|...:  ..:.|||||:|:::.:  ..:..|..|:||.|||.:..
 Worm    71 WSGVLDASKYSPACLSNSSTTSTPQ--EHVSEDCLYINIFTSE--KCLRSKCAVIVYFHGGAYNG 131

  Fly   266 GASNLFQGHILASFY---DVVVVTLNYRLGALGFLSTGDENSPG-----NYGILDQAMALRWVYD 322
            .::.:|..:.:...|   ||::.....|||..|.|..|    |.     |..:.|...||.:|::
 Worm   132 DSATMFPDNFILERYVAEDVILAIPGVRLGVFGQLYFG----PSALLTENLFMFDAVQALDFVHN 192

  Fly   323 NIEFFNGDRNSITLFGPGAGGASAGLL----MVAPQTRNIVRRVIAQSGSALADW--------AL 375
            .|..|.||...:|:.|..:||.....|    .|.|..: :.:::|..||:.:..:        .:
 Worm   193 EIPNFGGDPKQVTIMGHSSGGTLVEALGFSNSVDPDLK-LFQQIIVLSGTGMFGFYDLLVDNSFI 256

  Fly   376 IQDKY------RAQNTSRVLGQLLGC--------------SIESSWKLV-NCLRTGRSFYELGNA 419
            |.:|.      :.:.|...:.::|.|              .:|..:||. ..|..|..|.||.. 
 Worm   257 ISEKLGCFNGTQEERTDANIAEILECMRQIDGHEIVGMQKHMEDVYKLTFKSLLRGAPFMELNG- 320

  Fly   420 EFSPQVGSFPWGPVLDHNFTLP-----GDDWYEGWREKDWRFLTQTPETLIRAGKFNRNIQYMTG 479
                ::..|       .|.|.|     |...||                      |...::....
 Worm   321 ----KIEKF-------RNSTSPRNAIFGTTEYE----------------------FRNEVERYLY 352

  Fly   480 VTTQ----EAAFFVAQNESLSPYYELDGRFFDQKIREHVFRYNYTLNPNGV---YEAIKY----- 532
            :||.    |....|||:             ||.::.:::   :..:|.:.|   ..|..:     
 Worm   353 ITTTFLDFENPVAVAQH-------------FDDELMQNM---DTMINGDAVSIFVSAAAFSSAMA 401

  Fly   533 -----IYTF----WPDPNNNTIIRDQYINMLSDLYYRAPVDQMVKLMLEQKVPVYMY---VLNTT 585
                 :|.|    ||           |...:||:.|...:.:.|....:..:....|   ::|.|
 Worm   402 NAGADVYLFETRQWP-----------YSFHVSDMQYFIGIHREVLHTHDMDILDSFYSKLLVNFT 455

  Fly   586 VEALNLPQWRKYPHDIERYF------LTG-APFMDTEFFPKKEHLQRNMWTDNDRNMSHFFMQTY 643
            ......|:|.....:...|.      ..| .|.|...:..|:.........|.|||::..     
 Worm   456 KTGAPSPEWNSLEPEKMNYLELRVDTRNGKGPVMLEGYHDKEVSFWYGDMMDYDRNITKM----- 515

  Fly   644 TNFARYGNPTPQQVLGMHFQRAYQGEI------RYLNINTTYNSSILLNYRQTECAFWTQYLPTV 702
                |.....|::..|:..|..|...|      .:.|..|..|.|...|...|..|   ||:...
 Worm   516 ----RQSKGLPRENQGVESQLKYWSSIVEPRTTAHANNATQENISTSTNVLFTSTA---QYISRE 573

  Fly   703 IGVLVPTYPPTTEYWWEPKEPLQIAFWSMSVACFFLIVLVVICC-----IMWRNAKRQSD 757
            .    ....|..:.||                 |:||:.:|:..     |..|..:|:.:
 Worm   574 F----KNSTPILQQWW-----------------FYLIIALVVMIFVLIFISLRKPRREEE 612

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 134/642 (21%)
C23H4.7NP_741910.3 Abhydrolase 19..501 CDD:304388 117/565 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.