DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and Ces2a

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_653344.1 Gene:Ces2a RGDID:708353 Length:558 Species:Rattus norvegicus

Alignment Length:644 Identity:190/645 (29%)
Similarity:278/645 (43%) Gaps:143/645 (22%)


  Fly   103 PNARTQFPG----VLAGWREDLQGKQRRDSLTLERDVFVTTNYGQVQGFKVYMYDNPDPKSFYRP 163
            |.||  .||    |..|....||....:||.:..|:    |:.|||:|..|::   .|.||   .
  Rat     2 PLAR--LPGWLYVVACGLLLLLQHVHGQDSASPIRN----THTGQVRGSFVHV---KDTKS---G 54

  Fly   164 YHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRGWQLLQAVDFGPA-CPQP-------VRY 220
            .|:           |||||:|.||....||.||.....|..::.....|| |.|.       ::.
  Rat    55 IHT-----------FLGIPFAKPPVGPLRFAPPEDPEPWSGVRDATSQPAMCLQTDIMNLDGIKE 108

  Fly   221 TGATKGIMDMDEDCLYLNVYSPKTGAGVAQKYPVMVYIHGGEFIRGASNLFQGHILASFYDVVVV 285
            ...|.....|.|||||||:|:| ..|......||||:||||..:.|::::.....||:..::|:|
  Rat   109 MKLTVHPTPMSEDCLYLNIYTP-AHAREGSNLPVMVWIHGGGLVLGSASMNDASTLAATEEIVIV 172

  Fly   286 TLNYRLGALGFLSTGDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLM 350
            ::.||||.|||.||||:|:.||:|.|||..|||||..||.:|.|:...:|:||..|||.|....:
  Rat   173 SIQYRLGVLGFFSTGDQNARGNWGYLDQVAALRWVQQNIAYFGGNHGKVTIFGGSAGGTSVSSHV 237

  Fly   351 VAPQTRNIVRRVIAQSGSALADWALIQDKYRAQNTSRVLGQLLGCSIESSWKLVNCLRTGRSFYE 415
            |:|.::.:....|.|||.||.. .||.||  ::...:.:..|.||....|..|:.||| .:|..|
  Rat   238 VSPMSKGLFHGAIMQSGVALLP-DLISDK--SEVVYKTVANLSGCEAPDSEALIRCLR-AKSKQE 298

  Fly   416 L--GNAEFSPQVGSFPWGPVLDHNFTLPGDDWYEGWREKDWRFLTQTPETLIRAGKFNRNIQYMT 478
            :  .|..|.                .:||        ..|.:||.:.|:.|:.:|.|: .:..:.
  Rat   299 ILAINQVFK----------------MIPG--------VVDGKFLPKHPQELLASGDFH-PVPSII 338

  Fly   479 GVTTQEAAFFVAQNESLSPYYELDGRFFDQKIREHVFR---------------YNYTLNPNGVYE 528
            |:.|.|..:      .:..:..||          |:.:               ....|.|    |
  Rat   339 GINTDECGW------GIPVFLGLD----------HIIKKITRETLPTVLKSTAAQMMLPP----E 383

  Fly   529 AIKYIY-TFWPDPNNNTIIRDQYINMLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEALNLP 592
            .|..|. .:..|..|...:::|:.:||.|..:..|..|:......| .|||.|      |..:||
  Rat   384 CIDLIMEEYMGDTENPETLQEQFRHMLGDFMFVIPALQVAHFQRSQ-APVYFY------EFQHLP 441

  Fly   593 QWRKY--PHDIER-----------YFLTGAPFMDTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYT 644
            .:.|.  |..::.           .:|.|..|..||   ::|.|:|.:            |:.:.
  Rat   442 SFIKQVRPSHVKADHGDDILFVFGSYLWGMTFDLTE---EEELLKRRV------------MKYWA 491

  Fly   645 NFARYGNPTPQQVLGMHFQRAYQGEIRYLNINTTYNSSILLNYRQTECAFWTQYLPTVI 703
            ||||.|||..:.:  .|:......| :||.:||.......|..|:.:  |||:.||..|
  Rat   492 NFARTGNPNGEDL--PHWPVLDHDE-QYLQLNTQPAVGRALKARRLQ--FWTKTLPQKI 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 173/600 (29%)
Ces2aNP_653344.1 COesterase 30..537 CDD:278561 174/605 (29%)
Aes 70..>230 CDD:223730 66/161 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C90132087
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.