DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and Nlgn2

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001351066.1 Gene:Nlgn2 MGIID:2681835 Length:836 Species:Mus musculus

Alignment Length:710 Identity:215/711 (30%)
Similarity:316/711 (44%) Gaps:148/711 (21%)


  Fly    74 GANYPGRNPPGQYPQGMPNEDRFRFDPNDPNARTQFPGVLAGWREDLQGKQRRDSLTLERDVFVT 138
            ||...|..|.|..|.|                    ||:..|            ||..||...|.
Mouse    13 GAQRGGGGPGGGAPGG--------------------PGLGLG------------SLGEERFPVVN 45

  Fly   139 TNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRGWQ 203
            |.||:|:|.:                ....:.::|....|||:|||.||....||:||.....|.
Mouse    46 TAYGRVRGVR----------------RELNNEILGPVVQFLGVPYATPPLGARRFQPPEAPASWP 94

  Fly   204 -LLQAVDFGPACPQ-----------PVRYT----GATKGIMDMDEDCLYLNVY------------ 240
             :..|....|||||           ||.:|    .|...:.:..|||||||:|            
Mouse    95 GVRNATTLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKR 159

  Fly   241 ------SPKTGAGVAQKYPVMVYIHGGEFIRGASNLFQGHILASFYDVVVVTLNYRLGALGFLST 299
                  .|.|....:.|.|||:::|||.::.|..|:|.|.:||::.:|:|||||||||.||||||
Mouse   160 DEATLNPPDTDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSVLAAYGNVIVVTLNYRLGVLGFLST 224

  Fly   300 GDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNIVRRVIA 364
            ||:.:.||||:|||..||||:.:||..|.||...||:||.|||.:...||:::..:..:.::.||
Mouse   225 GDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIA 289

  Fly   365 QSGSALADWALIQDKYRAQNTSRVLGQLLGCSIESSWKLVNCLRTGRSFYELGNAEFSPQVGSFP 429
            |||:|::.|::   .|:....:|:|...:||..|.|.:.|.|||. :|..||.:.:..|......
Mouse   290 QSGTAISSWSV---NYQPLKYTRLLAAKVGCDREDSTEAVECLRR-KSSRELVDQDVQPARYHIA 350

  Fly   430 WGPVLDHNFTLPGDDWYEGWREKDWRFLTQTPETLIRAGKFNRNIQYMTGVTTQEAAFFV---AQ 491
            :|||:|.: .:|.|                 ||.|::.|:| .|...:.||...|...||   |:
Mouse   351 FGPVVDGD-VVPDD-----------------PEILMQQGEF-LNYDMLIGVNQGEGLKFVEDSAE 396

  Fly   492 NESLSPYYELDG---RFFDQKIREHVFR-YNYTLNPNGVYEAIKYIYTFWPDPNNNTIIRDQYIN 552
            :|        ||   ..||..:...|.. |.|....:.:.|.||::||.|.|.:|..:.|...:.
Mouse   397 SE--------DGVSASAFDFTVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRDNGEMRRKTLLA 453

  Fly   553 MLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEALNLPQWRKYPHDIERYFLTGAPFMD-TEF 616
            :.:|..:.||.....||..:.:.|||.|......:|...|:|....|..|..::.|.|.:. |:.
Mouse   454 LFTDHQWVAPAVATAKLHADYQSPVYFYTFYHHCQAEGRPEWADAAHGDELPYVFGVPMVGATDL 518

  Fly   617 FPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYGN---PTPQQVLGMH----------FQRAYQG 668
            ||..       ::.||..:|...|..:||||:.|:   |.||....:|          :.:....
Mouse   519 FPCN-------FSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSK 576

  Fly   669 EIRYLNINTTYNSSILLNYRQTECAFWTQYLPTVIGVLVPTYPPTTEY-----WWEPKEP 723
            |.:||:|.  ....:..|||..:.|||.:.:|.:..:....:..||..     .|.|:.|
Mouse   577 EKQYLHIG--LKPRVRDNYRANKVAFWLELVPHLHNLHTELFTTTTRLPPYATRWPPRTP 634

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 194/616 (31%)
Nlgn2NP_001351066.1 COesterase 42..601 CDD:306613 194/615 (32%)
Required for interaction with LHFPL4. {ECO:0000269|PubMed:28279354} 679..699
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D754103at2759
OrthoFinder 1 1.000 FOG0000341
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43903
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.