DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and F55F3.2

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_741921.1 Gene:F55F3.2 WormBaseID:WBGene00010116 Length:548 Species:Caenorhabditis elegans

Alignment Length:606 Identity:161/607 (27%)
Similarity:236/607 (39%) Gaps:143/607 (24%)


  Fly   164 YHSTVDRVMGECSV----------FLGIPYALPPTFEGRFKPPRVHRGWQLLQAVDFGPACPQPV 218
            |..||....|..::          |.||.||.||....||...|......|::|..:|..|   |
 Worm    23 YDVTVQTPNGSATIRGIQHTYGTSFRGIRYAQPPVGLFRFGAARRLDPVGLVEAQAYGNIC---V 84

  Fly   219 RYTGATKGIMDMDEDCLYLNVYSPKTGAGVAQKYPVMVYIHGGEFIRGASNLFQGHI--LASFYD 281
            :..|.|.     .||||::|||:| .....|.|.||.||||||.|:.|..|:..|..  |.:...
 Worm    85 QGDGRTS-----HEDCLFINVYTP-NNVTQASKLPVYVYIHGGGFVEGGGNMGAGIYPNLVNKGP 143

  Fly   282 VVVVTLNYRLGALGFLSTGDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASA 346
            :|:|::|||||..||.||....:|||:.|.|...||.||...|.||.||.|.:|:.|..:|..:.
 Worm   144 IVMVSINYRLGPFGFFSTRQMTAPGNWAISDWIEALNWVQRYISFFGGDPNRVTIGGQSSGAEAV 208

  Fly   347 GLLMVAPQTRNIVRRVIAQSGSALADWALIQDKYRAQNTSRVLGQLLGCSIESSW-------KLV 404
            ..|.:.|..:|:.::.|.:||||... |::....:.::||:.|...|||:....|       .::
 Worm   209 STLTLTPLAKNLFKQSIHESGSAFGA-AVMSYSEKTRSTSKQLSIKLGCATSDQWDNGQSFGTIL 272

  Fly   405 NCLRTGRSFYELGNAEFSPQVGSFPWGPVLDHNFTLPGDDWYEGWREK-----DWRFLTQTPETL 464
            .|||         |..:...|.:               |:...|.|.|     |.::|||..|.|
 Worm   273 TCLR---------NVTYDKIVAA---------------DNSLPGHRMKWSIVQDNKYLTQRLEYL 313

  Fly   465 IRAGKFNRNIQYMTGVTTQEAAFFVAQN----------------ESLSPYYELDGRFFDQKIREH 513
            .......:|:  :.|....|...:...|                :.||..||:  .::|.|....
 Worm   314 ALQRDPKKNV--LIGDVHDEWLGWEMNNVLHNINSSHNTAHQMRDDLSGSYEM--TYWDNKQSVL 374

  Fly   514 VFRYNYTLNPNGVYEAIKYIYTFWPDPNNNTIIRD---QYINMLSDLYYRAPVDQMVKLMLEQKV 575
            |...|..:|..|           |.|.|:    |:   :.|.:.|::.:..|..:........|.
 Worm   375 VAADNKYINNQG-----------WTDDNH----REWEARRIQLWSEMVFIGPTLRDAAYFQYMKN 424

  Fly   576 PVYMYVLNTTVEALNLPQWRKYPHDIERYFLTGAPFMDTEFFPKKEHLQRNMW------------ 628
            .||:|.|:          |...|         ..|.:....|...||    .|            
 Worm   425 NVYLYSLD----------WLSPP---------ALPLVTDPLFRGCEH----TWELQYIFSTSCNG 466

  Fly   629 ---TDNDRNMSHFFMQTYTNFARYGNPTPQQVLG--MHFQ-RAYQGEIRYLNINTTYNSSILLNY 687
               |..|..:.::|..|:.||...|||||   .|  :.|: .|.....|:|:.:.  |..:..:|
 Worm   467 FTCTAQDEILRNYFTTTWLNFIIGGNPTP---AGSPLPFKWLAMDSTNRFLSFSP--NPKMQPHY 526

  Fly   688 RQTECAFWTQYLPTVIGVLVP 708
             ..:..||....||:.|...|
 Worm   527 -HPDSMFWVCTAPTIDGYKGP 546

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 156/592 (26%)
F55F3.2NP_741921.1 Abhydrolase 22..510 CDD:304388 151/566 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.