DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and F15A8.6

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001317902.1 Gene:F15A8.6 WormBaseID:WBGene00017478 Length:585 Species:Caenorhabditis elegans

Alignment Length:606 Identity:169/607 (28%)
Similarity:259/607 (43%) Gaps:121/607 (20%)


  Fly   137 VTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRG 201
            |.|..|.|:||::.:.|               ||   |..:|||||:|..|..:.|||.|.....
 Worm    44 VRTRNGLVEGFRIKIDD---------------DR---EVDMFLGIPFAKAPVGDLRFKNPEHTED 90

  Fly   202 WQ-LLQAVDFGPACPQP----VRYT-GATKGIMDMDEDCLYLNVYSPKTGAGVAQK--YPVMVYI 258
            |. :.:.|.|||..||.    .|:| |..|     .||||||||:||...|.....  :|||||:
 Worm    91 WDGVKKCVRFGPRAPQADFFWERFTLGVGK-----SEDCLYLNVFSPTWKAEEVSNGLHPVMVYV 150

  Fly   259 HGGEFIRGASNLFQGHILASF---YDVVVVTLNYRLGALGFLSTGDENSPGNYGILDQAMALRWV 320
            |||.|:..::..:....:|.:   :.|||||:.||||.|||.||||:..|||.|:.|..|||:||
 Worm   151 HGGGFLIDSAVKYGDEGIAKYLCRHGVVVVTIQYRLGLLGFFSTGDQVCPGNLGLWDMTMALQWV 215

  Fly   321 YDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNIVRRVIAQSGSALADWALI--------- 376
            .||:..|.||...:|:||..|||.|..||.::|.:|::..:|:..:|:...:|:.:         
 Worm   216 RDNVHAFGGDPRKVTVFGQSAGGVSVDLLSLSPHSRDLFHQVVPMAGNGECEWSTVGKNRLVNAC 280

  Fly   377 ----------QDKYRAQNTSRVLGQLLGCSIESSWKLVNCLRTGRSFYELGNAEFSPQVGSFPWG 431
                      :.:.|.:|.|..:.:.|....|..::.....|.|....::| .:.:|.:||    
 Worm   281 REFAYRKCWDEKQARDENASESMLEFLRTRKEREFEKRLLTRKGVDVSKIG-LDLAPVIGS---- 340

  Fly   432 PVLDHNFTLPGDDWYEGWREKDWRFLTQTPETLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESLS 496
                    .|.|            ||.::.|.| |.....:||  |.|....|...|.    ||.
 Worm   341 --------KPSD------------FLPKSIEEL-RKEAPKKNI--MVGTCEHEGLLFA----SLG 378

  Fly   497 PYYELDGRFFDQKIREHVFRYNYTLNPNGVYEAIK------YIYTFWPDPNNNTIIRDQYINMLS 555
            |      ..||:|..:.:.....|...:..:||::      |:.....|.::..:....||.:.|
 Worm   379 P------SNFDEKGIDKLLALLITEENHEDFEALREEAKKMYLKKLSDDEDDKEVAARGYIQLYS 437

  Fly   556 DLYYRAPVDQMVKLMLEQKVPVYMYVLNTT------VEALNLPQWRKYPHDIERYFLTGAPFMDT 614
            ||:.........:.|.:....|:||..:..      :.:|..| :|...|..|..::.|...:  
 Worm   438 DLFVNNGTYNYAEKMTKLGNKVFMYSFDYCNPRSFGILSLRAP-FRAATHCTELAYIFGVSIV-- 499

  Fly   615 EFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYGNPTPQ----QVLGMHFQRAYQGE-IRYLN 674
              |..:       :.::||.|.....:.:||||:||||..|    .|....::...:.| ..:|.
 Worm   500 --FNYR-------YNESDRAMLDLMTKMWTNFAKYGNPNGQYEDSTVFDFKWEPTSKEEPTNFLA 555

  Fly   675 INTTYNSSILLNYRQTECAFW 695
            ||.. ...:...|:.....||
 Worm   556 INEK-KCEMQTVYQDNRAEFW 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 168/605 (28%)
F15A8.6NP_001317902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.