DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and F13H6.3

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_504621.1 Gene:F13H6.3 WormBaseID:WBGene00017431 Length:554 Species:Caenorhabditis elegans

Alignment Length:640 Identity:175/641 (27%)
Similarity:260/641 (41%) Gaps:211/641 (33%)


  Fly   129 LTLERDV-FVTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGR 192
            ||.|::| .:..:.|.|:| .:|.:|:           ..||.       :||||||.||..|.|
 Worm     8 LTPEQNVEALKASCGPVRG-NIYKHDD-----------VIVDG-------YLGIPYAKPPVGELR 53

  Fly   193 FKPPRVHRGW-QLLQAVDFGPACPQPVRYTGATKGI------MDMDEDCLYLNVYSPKTGAGVAQ 250
            ||.|.....| ::.....:||||.|    ||..:.|      ...:..||.|||::|:..:...:
 Worm    54 FKKPVTVDVWTEIKDCYKYGPACVQ----TGGFEQIAGPRTPTPEEAGCLTLNVFTPRNASSEFK 114

  Fly   251 K-YPVMVYIHGGEFIRGASNLFQGHILAS---FYDVVVVTLNYRLGALGFLSTGDENSPGNYGIL 311
            . .|||||||||.:...||:.|..:.|:.   ..|||||::|||||..|||:|||...|||:|:.
 Worm   115 NGRPVMVYIHGGGYELCASSDFCAYSLSGTLPLKDVVVVSINYRLGVFGFLTTGDNVCPGNFGLW 179

  Fly   312 DQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNIVRRVIAQSGSALADWALI 376
            ||.:||:||..:|..|.||.|.:|:||..|||||..||.::|.:|::.:|.|..||:|..|:|: 
 Worm   180 DQTLALKWVQKHISSFGGDPNCVTVFGQSAGGASTDLLSLSPHSRDLFQRFIPISGTAHCDFAI- 243

  Fly   377 QDKYRA-QNTSRVLGQLLGCSIESSWKLVNCLRTGRSFYELGNAEFSPQVGSFPWGPVLDHNFTL 440
                || :|.:::.                     |.|     |||              |.|: 
 Worm   244 ----RASENQAKIF---------------------REF-----AEF--------------HGFS- 263

  Fly   441 PGDD------WYEGWREKDWRFLTQTPETLIRAGKFNRNI------------------------- 474
             |.|      ||:          .|:||||.....:.::|                         
 Worm   264 -GRDSSALFKWYQ----------EQSPETLSNVKGYKKSISGFLTFIPNLDGDFFPKPLDELRKE 317

  Fly   475 ----QYMTGVTTQEAAFFVAQNESLSPYYELDGRFFDQKIREHVFRYNYTLNPNGVY-------- 527
                |.|||||..|.....:.|.:.||                 .....||.|.|:|        
 Worm   318 APKKQMMTGVTEYEGLMLASMNPAFSP-----------------ADVGLTLMPQGIYGKDVVSNP 365

  Fly   528 EAIKYI----YTFWPDPNNNTIIRDQYINMLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEA 588
            :.|:.|    |....|.::...:|.:....|.|.::...|.|..|...:....||.|    |.|.
 Worm   366 DEIQKIFYEKYVEGVDKSDELAMRKKLCEALGDEFFNVGVIQAAKNAAKHGNEVYFY----TFEY 426

  Fly   589 LN---------LPQWRKYPHDIERYFLTGAPFMDTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYT 644
            :|         :..::...|..|..:|.|.. :.::|.|          |:.||.:.......::
 Worm   427 VNPDSFGMWDGMMPFKAAVHCTELRYLLGEG-VYSKFEP----------TEEDRKVMETTTTLFS 480

  Fly   645 NFARYGNPT----------------PQQVLGMHFQRAY----------QGEIRYL 673
            |||:||||.                |::    |::.:|          :|.|::|
 Worm   481 NFAKYGNPNGKGATAEIWEKYSLNRPER----HYRISYPKCEMRDVYHEGRIQFL 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 172/636 (27%)
F13H6.3NP_504621.1 Esterase_lipase 16..521 CDD:238191 168/621 (27%)
Aes <103..>224 CDD:223730 57/121 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.