DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and C42D4.2

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_501133.3 Gene:C42D4.2 WormBaseID:WBGene00016595 Length:579 Species:Caenorhabditis elegans

Alignment Length:602 Identity:131/603 (22%)
Similarity:218/603 (36%) Gaps:164/603 (27%)


  Fly   135 VFVTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVH 199
            |.|.|:.|::.|.::                       |...:|..||:|.||..:.||:.|:..
 Worm    22 VIVETSLGKLNGDQI-----------------------GNFHLFKKIPFAKPPLGKLRFQKPQPA 63

  Fly   200 RGWQ-LLQAVDFGPACPQPVRYTGATKGIMD-MDEDCLYLNVYSPKTGAGVAQKYPVMVYIHGGE 262
            ..|. :..|.|:||||   :..:..||.:.. :|||||:||:::.:| ...::...|::|:|||.
 Worm    64 ETWNGVRNAKDYGPAC---MSNSSTTKTVQKWVDEDCLHLNIFTSET-CLKSKNCAVVIYLHGGN 124

  Fly   263 FIRGASNLFQGHILASFY---DVVVVTLNYRLGALGFLSTGDEN-SPGNYGILDQAMALRWVYDN 323
            ....::.:|....|...|   ::|.|....|||........|:: :|.|..:.|...|:.:...:
 Worm   125 LHYDSAVMFNDTFLLHTYASQEIVFVIPAVRLGIFSHFVVEDQSIAPNNLALFDMLQAMEFAKSD 189

  Fly   324 IEFFNGDRNSITLFGPGAGGASAGLLMVAPQTR---NIVRRVIAQSGSALADWALIQ-------- 377
            |..|.|:....||.|...||..|.:|..:.:..   ::.::.|:.|.....|...:|        
 Worm   190 IHNFGGNNKRTTLLGHSYGGTVASMLSFSTKVNTDLSLFQQYISMSSPTNFDTLELQVERTYRFA 254

  Fly   378 ---------DKYRAQNTSRVLGQLLGCSIESSWKLVNCLRTGRSFYELGNAEFSPQVGSFPWGPV 433
                     .|:..:|...|  .:..|..:.|  ....||..||..|.|...:.   ||...||:
 Worm   255 EHANCLPKNSKFMRKNQKEV--YMRDCLKKKS--ASELLRIQRSLEEAGYPVYG---GSVMRGPI 312

  Fly   434 LDHNFTLPGDDWYEGWREKDWRFLTQTPETLIRAGKFNRNIQYMTGVTTQEAAFFVAQNESLSPY 498
                        ::...|:|:   ..:|          .||..:||.|..|:..:        .:
 Worm   313 ------------FQEVLERDF---MDSP----------NNITSLTGCTKYESLVY--------DH 344

  Fly   499 YELDGRFFDQKIREHVFRYNYTLNPNGVYEAIKYIYTFWPDPNNNTIIRDQYIN----MLSDLYY 559
            |...|:....:..|.|         |..|.:         |.....|..|...|    ||..:..
 Worm   345 YRNMGKALGFENYEEV---------NEKYRS---------DSKEGKIEFDNVKNATQIMLIQIRT 391

  Fly   560 RAPVDQMVKLMLEQKVPVYMYVLNTTVEALNLPQWRKYP----HDIERYFLTGA-PFMDTEFFPK 619
            |      |..:|::.:|.|.|..             .||    |..:.:|:.|. ||:..|    
 Worm   392 R------VNKILKKNIPAYHYEY-------------AYPKHANHTDDLFFIMGVHPFIQDE---- 433

  Fly   620 KEHLQRNMWTDNDRNMSHFFMQTYTNFARYGNPTPQQVLGMHFQRAYQGEIRYLNIN---TTYNS 681
                       |:..:.:|:...:.||.:.|||      |.....|......|..:|   ||...
 Worm   434 -----------NEIKLGNFYRSMFLNFIKTGNP------GNGCDGANLNGSTYFEVNWNETTGER 481

  Fly   682 SILL-NYRQTECAFWTQ 697
            .::. |:.|....:||:
 Worm   482 PVMKNNFEQKILDYWTK 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 129/599 (22%)
C42D4.2NP_501133.3 Abhydrolase 20..496 CDD:304388 129/599 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.