DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and C01B10.10

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_501021.3 Gene:C01B10.10 WormBaseID:WBGene00015284 Length:583 Species:Caenorhabditis elegans

Alignment Length:577 Identity:134/578 (23%)
Similarity:224/578 (39%) Gaps:164/578 (28%)


  Fly   137 VTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRG 201
            :.|:.|:::|                       :..|:..:|..||:|.||....||:.|.....
 Worm    24 IKTSLGRLEG-----------------------KQSGKYQLFRRIPFAKPPIGTLRFQKPESAEK 65

  Fly   202 WQ-LLQAVDFGPACPQPVRYTGATKGIMDMDEDCLYLNVYSPKTGAGVAQKYPVMVYIHGGEFIR 265
            |. :..|.::||||.....:|.:.:  ..:|||||::|::: ......::...|:|||||||.:.
 Worm    66 WNGVWNATEYGPACMSNSTWTQSPQ--KWVDEDCLHVNIFT-SDKCLKSKDCAVVVYIHGGEIVF 127

  Fly   266 GASNLFQG-HILASF--YDVVVVTLNYRLGALGFLSTGDEN-SPGNYGILDQAMALRWVYDNIEF 326
            .::.:|.. .:|.||  .||::|...:|||.....:..|:| :|.|..:.|..:|..:|...|..
 Worm   128 DSAVMFNDTFLLESFVKQDVILVIPAFRLGIFSHFTVHDQNIAPNNLALYDIILAQEFVKSEIHN 192

  Fly   327 FNGDRNSITLFGPGAGGASAGLLMVAP---QTRNIVRRVIAQSGSALADWALIQDKYRAQNTSRV 388
            |.||...|||||...||..|.::..:.   |..::.:|:|..|.:...|..    :.:.:.:.||
 Worm   193 FGGDIQKITLFGHSYGGTIASMMAFSSEINQDLSLFQRIIVMSANQYFDTL----EEQIERSDRV 253

  Fly   389 LGQLLGCSIESSWK-----------LVNCLR---------TGRSFYELGNAEFSPQVGSFPWGPV 433
            : :..|||:.::..           ::.||:         ..||..|.|    .|.:|       
 Worm   254 V-KHAGCSVPTNLARKMNRSQKEKYMMKCLQKLSGMELLSVQRSLEEAG----YPDIG------- 306

  Fly   434 LDHNFTLPGDDWYEGWREKDWRFLTQTPETLIRAGKFNRNIQYMTGVT-----TQEAAFFVAQNE 493
               |..|.|.           .|...|...::.:.|.   |..:.|.|     .::...|:.::.
 Worm   307 ---NLVLRGP-----------LFPDVTSLEMLESPKM---IPMLAGCTKFESDDEDETHFIGKHF 354

  Fly   494 SLSPYYELDGRFFDQKIREHVFRYNYTLNPNGVYEAIKYIYTFWPDPNNNTIIRDQYINMLSDLY 558
            .|....|.     |:|.|:.:        .||:::            ..|...:.|.|.:.:.| 
 Worm   355 GLENPIEC-----DEKYRKDL--------ENGIFD------------RQNHSDKTQAIMVPTKL- 393

  Fly   559 YRAPVDQMVKLMLEQKVPVYMYVLNTTVEALNLPQWRKYP----HDIERYFLTGA-PFMDTEFFP 618
               .|||:.|    ..||.|:|...             ||    |..:.|::.|. ||...|   
 Worm   394 ---RVDQLRK----HGVPAYLYEFT-------------YPKHAFHTDDLYYIMGIHPFEKDE--- 435

  Fly   619 KKEHLQRNMWTDNDRNMSHFFMQTYTNFARYGNPTPQQVLGMHFQRAYQGEIRYLNI 675
            .:|||::..     |||       ..||.::|.|      ||.|:.:...|..|..|
 Worm   436 NEEHLEKVY-----RNM-------LINFIKFGEP------GMGFEMSDLNESTYFEI 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 134/578 (23%)
C01B10.10NP_501021.3 Abhydrolase 23..498 CDD:304388 134/578 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.