DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and Y71H2AM.13

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_497609.1 Gene:Y71H2AM.13 WormBaseID:WBGene00022178 Length:550 Species:Caenorhabditis elegans

Alignment Length:588 Identity:149/589 (25%)
Similarity:228/589 (39%) Gaps:187/589 (32%)


  Fly   137 VTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSV--FLGIPYALPPTFEGRFKPPRVH 199
            |.|:||.::|              .|..|.      ||..|  |.|||||.||....||..|:.|
 Worm    19 VLTSYGPIEG--------------RRLIHE------GEKQVDAFQGIPYAAPPIGNLRFALPQPH 63

  Fly   200 RGW-QLLQAVDFGPACPQPVRYTGATKGIM----------DMDEDCLYLNVYSP------KTGAG 247
            ..| ::.:...||            .:||.          ...||.|.||:::|      :||  
 Worm    64 EKWTEVRETKSFG------------ARGIQKDHVLSPKTSPQSEDNLTLNIFTPVWTPKNETG-- 114

  Fly   248 VAQKYPVMVYIHGGEFIRGASNLFQG-----HILASFYDVVVVTLNYRLGALGFLSTGDENSPGN 307
                :||::|||||.|:..:::.:..     |::..  ||||||:.||||.|||.:|||.:.|.|
 Worm   115 ----FPVILYIHGGGFVSDSAHKYGDMSICQHLVTK--DVVVVTIQYRLGFLGFWTTGDSSIPDN 173

  Fly   308 YGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGASAGLLMVAPQTRNIVRRVIAQSGSALAD 372
            ..:.|...||:||.:||..||||.|:|||.|..|||||...|.::|.:|::.::||...|:|...
 Worm   174 VALHDMVFALKWVKENIGLFNGDPNNITLMGQSAGGASVDFLSISPVSRDLFQKVIPMGGNASCS 238

  Fly   373 WALIQDKYRAQNTSRVLGQLLGCSIESSWKLVNCLRTGRSFYELGNAEFSPQVGSFPWGPVLDHN 437
            ||:   ..|..|..|...|.:|                                      |.|..
 Worm   239 WAI---HPRPLNACRNRAQEIG--------------------------------------VFDGM 262

  Fly   438 FTLPGDDWYEGWRE--KDWRFL---------TQTPETLIRAGKFN-----RNIQYMT-------- 478
            .||   ||.|..||  .| :|.         |:|...|:...|::     |.:..:.        
 Worm   263 NTL---DWVEKLRELPAD-KFASALNMEAVDTKTDPELLIGPKYDNLFIPRPVMELRKEAPMKPR 323

  Fly   479 ---------------GVTTQEAAFFVAQNESLSPYYELDGRFFDQKIREHVFRYNYTLNPNGVYE 528
                           |:.|:.....|.|:.|..    |..:.|..|.|::            ..:
 Worm   324 LLGCAKSEGLVFAFFGLNTKHPLHAVQQDVSAI----LSEKLFPLKARDY------------QEK 372

  Fly   529 AIKYIYTFWPDPNNNTIIRDQYINMLSDLYYRAPVDQMVKLMLEQK--VPVYMYVLNTT------ 585
            |::.:.....|.:.....| ..:::..|.:....:.|.|..:||.:  .|:|||..:..      
 Worm   373 ALEKLIEIGTDHSKEEWQR-AMVDLKGDSFLNVGIQQNVLDVLETQPSTPIYMYSFDYCNPKAYG 436

  Fly   586 VEALNLPQWRKYPHDIERYFLTGAPFMDTEFFPKKEHLQRNM-WTDNDRNMSHFFMQTYTNFARY 649
            :....|| ::...|..:..::.|            .|:..:. :.:.|..|.....:.:||||:|
 Worm   437 IMGFKLP-FKDATHCTDISYVVG------------NHIVNSFDFNEEDYKMIEITTRLWTNFAKY 488

  Fly   650 GNP 652
            |||
 Worm   489 GNP 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 149/589 (25%)
Y71H2AM.13NP_497609.1 COesterase 14..530 CDD:278561 149/589 (25%)
Aes 89..>209 CDD:223730 53/128 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.