DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gli and Ces2a

Sequence 1:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_598721.1 Gene:Ces2a MGIID:2142491 Length:558 Species:Mus musculus

Alignment Length:650 Identity:188/650 (29%)
Similarity:278/650 (43%) Gaps:155/650 (24%)


  Fly   103 PNARTQFPG----VLAGWREDLQGKQRRDSLTLERDVFVTTNYGQVQGFKVYMYDNPDPKSFYRP 163
            |.||  .||    |..|....||....:||.:..|:    |:.|||:|..|::   .|.||   .
Mouse     2 PLAR--LPGWLCVVACGLLLLLQHVHGQDSASPIRN----THRGQVRGSFVHV---KDTKS---G 54

  Fly   164 YHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRGWQLLQAVDFGPA-CPQPVRYTGATKGI 227
            .|:           |||||:|.||....||.||.....|..::.....|| |.||        .|
Mouse    55 VHA-----------FLGIPFAKPPVGLLRFAPPEDPEPWSGVRDGTSQPAMCLQP--------DI 100

  Fly   228 MD---------------MDEDCLYLNVYSPKTGAGVAQKYPVMVYIHGGEFIRGASNLFQGHILA 277
            |:               |.|||||||:|:| |.|......||||:||||..:.|::::.....||
Mouse   101 MNLEDAKEMNLILPPISMSEDCLYLNIYTP-THAQEGSNLPVMVWIHGGGLVVGSASMNDVSKLA 164

  Fly   278 SFYDVVVVTLNYRLGALGFLSTGDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAG 342
            :..::|:|.:.||||.|||.||||:::.||:|.|||..|||||..||.:|.|:|:.:|:||..||
Mouse   165 ATEEIVIVAIQYRLGVLGFFSTGDQHARGNWGYLDQVAALRWVQKNIAYFGGNRDRVTIFGVSAG 229

  Fly   343 GASAGLLMVAPQTRNIVRRVIAQSGSALADWALIQDKYRAQNTSRV----LGQLLGCSIESSWKL 403
            |.|....:::|.::.:....|.|||.||.. .||.|      ||.|    :..|.||....|..|
Mouse   230 GTSVSSHILSPMSKGLFHGAIMQSGVALLP-DLISD------TSEVVYKTVANLSGCEATDSEAL 287

  Fly   404 VNCLRTGRSFYEL--GNAEFS--PQVGSFPWGPVLDHNFTLPGDDWYEGWREKDWRFLTQTPETL 464
            ::||| .:|..|:  .|..|.  |.|                          .|..||.:.|:.|
Mouse   288 IHCLR-AKSKQEILAINQVFKMIPAV--------------------------VDGEFLPKHPQEL 325

  Fly   465 IRAGKFNRNIQYMTGVTTQEAAFFVAQNESLSPYYELDGRFFDQKIREHVFRYNYT--------- 520
            :.:..|: .:..:.||.|.|..:.|.....|                :|:.: |.|         
Mouse   326 LTSMDFH-PVPSIIGVNTDECGWGVPMFMGL----------------DHIIK-NITRETLPAVLK 372

  Fly   521 -------LNPNGVYEAIKYIYTFWPDPNNNTIIRDQYINMLSDLYYRAPVDQMVKLMLEQKVPVY 578
                   |.|...:..::   .:..|..:...::.|:..||.|..:..|..|:......| .|||
Mouse   373 NTAARMMLPPECSHLLVE---EYMGDTEDPETLQAQFREMLGDFMFVIPALQVAHFQRSQ-APVY 433

  Fly   579 MYV---LNTTVEALNLPQWRKYPHDIERYFLTGAPF--MDTEFFPKKEHLQRNMWTDNDRNMSHF 638
            .|.   |::.::.:. |...|..|..:..|:.|:..  |:.:...::|.|:|.|           
Mouse   434 FYEFQHLSSFIKHVR-PSHVKADHGDDVAFVFGSYLWDMNLDLTEEEELLKRMM----------- 486

  Fly   639 FMQTYTNFARYGNPTPQQVLGMHFQRAYQGEIRYLNINTTYNSSILLNYRQTECAFWTQYLPTVI 703
             |:.:.||||.|||..:   |:........:.:||.::|.......|..|:.:  |||:.||..|
Mouse   487 -MKYWANFARNGNPNSE---GLPSWPVLDHDEQYLQLDTQPAVGRALKARRLQ--FWTKTLPQKI 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 171/606 (28%)
Ces2aNP_598721.1 COesterase 30..537 CDD:278561 172/611 (28%)
Aes <127..>230 CDD:223730 49/104 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C90129476
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.