DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15253 and TNFAIP6

Sequence 1:NP_609758.1 Gene:CG15253 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_009046.2 Gene:TNFAIP6 HGNCID:11898 Length:277 Species:Homo sapiens

Alignment Length:67 Identity:15/68 (22%)
Similarity:27/68 (40%) Gaps:20/68 (29%)


  Fly     1 MCYYSILLLLLVVVNVAWAAPSIRIETDPELTAGYIE----------------GDMVPSG--SSR 47
            :||:.|.|.....:::::.  ...:|.||...|.|:|                ||.:|..  |:.
Human   160 ICYWHIRLKYGQRIHLSFL--DFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTG 222

  Fly    48 NI 49
            |:
Human   223 NV 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708
ZnMc_astacin_like 59..246 CDD:239807
TNFAIP6NP_009046.2 Link_domain_TSG_6_like 36..128 CDD:239592
CUB 135..244 CDD:278839 15/68 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.