DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15253 and Tll1

Sequence 1:NP_609758.1 Gene:CG15253 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099551.1 Gene:Tll1 RGDID:1306120 Length:1013 Species:Rattus norvegicus

Alignment Length:229 Identity:80/230 (35%)
Similarity:114/230 (50%) Gaps:18/230 (8%)


  Fly    37 EGDMVPSGSSRN----IWRNETYR----WPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTF 93
            :|...|..|.:|    :.|..|.|    ||..:|.|.|........|.....|::..|..:|:||
  Rat   129 KGKAPPKLSEQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTF 193

  Fly    94 KEATTDQKYYVNVTSEEGGCFSYIGYL-NRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQ 157
            .| .:|::.|:..|....||.||:|.. |..|.::     ||..|.:...:|||..|.:||:|:.
  Rat   194 TE-RSDEESYIVFTYRPCGCCSYVGRRGNGPQAIS-----IGKNCDKFGIVVHELGHVIGFWHEH 252

  Fly   158 SAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKN-GERTILAL- 220
            :..|||::|.|:.|||..|.|:||.|.....||..||:||:.|:|||....||:. ...|||.. 
  Rat   253 TRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSR 317

  Fly   221 -EEGKEDVIGQRLELSETDIRKLNAIYKCPTVKE 253
             :.|....||||..||:.||.:...:|:||...|
  Rat   318 DDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGE 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 73/203 (36%)
ZnMc_astacin_like 59..246 CDD:239807 67/191 (35%)
Tll1NP_001099551.1 ZnMc_BMP1_TLD 148..347 CDD:239808 73/205 (36%)
Astacin 155..348 CDD:279708 72/199 (36%)
CUB 349..458 CDD:278839 1/4 (25%)
CUB 462..571 CDD:278839
FXa_inhibition 582..614 CDD:291342
CUB 618..727 CDD:278839
FXa_inhibition 734..769 CDD:291342
CUB 774..883 CDD:278839
CUB 887..1000 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.