DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and CG34370

DIOPT Version :10

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_995921.2 Gene:CG34370 / 5740565 FlyBaseID:FBgn0085399 Length:952 Species:Drosophila melanogaster


Alignment Length:237 Identity:56/237 - (23%)
Similarity:85/237 - (35%) Gaps:69/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CYYSILLLLLVVVNVAWAAPSIRIETDPELTAGYIE----------GDMVPSGSSRNIWRNETYR 56
            |...:|||||.:|....|.||......|:...|...          |....||||.::.|:    
  Fly    16 CGLLMLLLLLQLVGERLATPSPSSMQAPQKRGGSGSGGGGGGGGGGGGGGGSGSSSDVSRD---- 76

  Fly    57 WPNRIIYYHINSYID--EEHRNHIVSAIQKIESISC----LTFKEATTD-------QKYYV---- 104
                    |.|..:|  |:..:..||.......::|    .|.|.|..|       :|:.|    
  Fly    77 --------HCNKTVDIFEDISSPEVSNQNVGRPLTCWYRFRTLKGAPRDFVLRLRFKKFKVGQLL 133

  Fly   105 NVTSEEGGCFSYIGYLNRVQQLNLQN-NEIGVGCFRLYTIVHEFLHALGFFHQ-QSAADRDDYVQ 167
            |.|..|||   |:..::...:.::.| .|.|:.|              |...| |:......||:
  Fly   134 NATHCEGG---YLQIVDGNAKTDVSNRREPGMFC--------------GEAEQPQTFISETSYVK 181

  Fly   168 IV--EENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPY 207
            ::  .:|.|:...|.||...|:..    |.|     :.||.:
  Fly   182 VLFHTDNFTDQTYFTFDSRAEQQT----EVY-----LRYGQH 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 ZnMc_astacin_like 59..246 CDD:239807 38/170 (22%)
CG34370NP_995921.2 CUB 88..195 CDD:238001 26/123 (21%)
CUB 244..363 CDD:238001
CUB 407..509 CDD:238001
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.