DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15253 and CG34370

Sequence 1:NP_609758.1 Gene:CG15253 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001097404.2 Gene:CG34370 FlyBaseID:FBgn0085399 Length:952 Species:Drosophila melanogaster

Alignment Length:237 Identity:56/238 (24%)
Similarity:85/238 (36%) Gaps:69/238 (29%)


  Fly     2 CYYSILLLLLVVVNVAWAAPSIRIETDPELTAGYIE----------GDMVPSGSSRNIWRNETYR 56
            |...:|||||.:|....|.||......|:...|...          |....||||.::.|:    
  Fly    16 CGLLMLLLLLQLVGERLATPSPSSMQAPQKRGGSGSGGGGGGGGGGGGGGGSGSSSDVSRD---- 76

  Fly    57 WPNRIIYYHINSYID--EEHRNHIVSAIQKIESISC----LTFKEATTD-------QKYYV---- 104
                    |.|..:|  |:..:..||.......::|    .|.|.|..|       :|:.|    
  Fly    77 --------HCNKTVDIFEDISSPEVSNQNVGRPLTCWYRFRTLKGAPRDFVLRLRFKKFKVGQLL 133

  Fly   105 NVTSEEGGCFSYIGYLNRVQQLNLQN-NEIGVGCFRLYTIVHEFLHALGFFHQ-QSAADRDDYVQ 167
            |.|..|||   |:..::...:.::.| .|.|:.|              |...| |:......||:
  Fly   134 NATHCEGG---YLQIVDGNAKTDVSNRREPGMFC--------------GEAEQPQTFISETSYVK 181

  Fly   168 IV--EENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPY 207
            ::  .:|.|:...|.||...|:..    |.|     :.||.:
  Fly   182 VLFHTDNFTDQTYFTFDSRAEQQT----EVY-----LRYGQH 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 38/175 (22%)
ZnMc_astacin_like 59..246 CDD:239807 38/171 (22%)
CG34370NP_001097404.2 CUB 88..195 CDD:238001 26/124 (21%)
CUB 244..363 CDD:238001
CUB 407..509 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C128965131
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.