DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15253 and tll1

Sequence 1:NP_609758.1 Gene:CG15253 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_571085.1 Gene:tll1 ZFINID:ZDB-GENE-041020-1 Length:1022 Species:Danio rerio

Alignment Length:221 Identity:81/222 (36%)
Similarity:112/222 (50%) Gaps:18/222 (8%)


  Fly    45 SSRNIW----RNETYR----WPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQK 101
            |:||:.    |..|.|    ||..:|.|.|........|..:..|::..|..:|:||.| .||::
Zfish   146 SARNVKSRVPRAATSRAEKIWPGGVIPYVIGGNFTGSQRAMLKQAMRHWEKQTCVTFIE-KTDEE 209

  Fly   102 YYVNVTSEEGGCFSYIGYL-NRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDY 165
            .|:..|....||.||:|.. |..|.::     ||..|.:...:|||..|.:||:|:.:..||||:
Zfish   210 SYIVFTYRPCGCCSYVGRRGNGPQAIS-----IGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDH 269

  Fly   166 VQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKN-GERTILAL--EEGKEDV 227
            |.|:.:||..|.|:||.|.....||..||.||:.|:|||....||:. ...|||..  |.|....
Zfish   270 VTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPA 334

  Fly   228 IGQRLELSETDIRKLNAIYKCPTVKE 253
            ||||..||:.||.:...:|:||...|
Zfish   335 IGQRTRLSKGDISQAKKLYRCPACGE 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 75/203 (37%)
ZnMc_astacin_like 59..246 CDD:239807 69/191 (36%)
tll1NP_571085.1 ZnMc_BMP1_TLD 157..356 CDD:239808 75/205 (37%)
Astacin 164..357 CDD:279708 74/199 (37%)
CUB 358..467 CDD:278839 1/4 (25%)
CUB 471..580 CDD:278839
FXa_inhibition 591..623 CDD:291342
CUB 627..736 CDD:278839
FXa_inhibition 743..778 CDD:291342
CUB 783..892 CDD:278839
CUB 896..1009 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.