DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15253 and Nrx-1

Sequence 1:NP_609758.1 Gene:CG15253 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001262840.1 Gene:Nrx-1 FlyBaseID:FBgn0038975 Length:1847 Species:Drosophila melanogaster

Alignment Length:195 Identity:40/196 (20%)
Similarity:82/196 (42%) Gaps:61/196 (31%)


  Fly     4 YSILLLLLVVVNVAWAAPSIRIETDPELTAGY-IEGDMVPSGSSRNIWRNETY---RWPNRIIYY 64
            |.:|::..::|::|.:..:        |:||: ::|.           :|..|   :|     |.
  Fly    82 YRVLIVSALLVSLAASFVT--------LSAGFQLDGS-----------QNSFYTFRKW-----YT 122

  Fly    65 HINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQ-QLNL 128
            .:|..::                   |.||   |:|...:.:.:::||.:.:. .|..|: .|.|
  Fly   123 GLNGTLE-------------------LEFK---TEQPNGLVLYTDDGGTYDFF-ELKLVEGALRL 164

  Fly   129 QNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENI-----TEGMEFNFDKYTEET 188
            :.| :|.|. ::.|:..| ||. |.:|:......|:...::.:.:     |:|.||.|.|:...:
  Fly   165 RYN-LGGGA-QIITVGRE-LHD-GHWHKVQVLRNDEQTSLIVDGVSQQRSTKGKEFQFGKFASNS 225

  Fly   189  188
              Fly   226  225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 31/144 (22%)
ZnMc_astacin_like 59..246 CDD:239807 29/137 (21%)
Nrx-1NP_001262840.1 LamG 110..263 CDD:238058 32/160 (20%)
EGF_CA 311..347 CDD:238011
Laminin_G_2 386..517 CDD:280389
LamG 555..716 CDD:238058
EGF 746..777 CDD:278437
Laminin_G_2 814..945 CDD:280389
LamG 988..1136 CDD:238058
EGF 1164..1195 CDD:278437
Laminin_G_2 1233..1356 CDD:280389
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C128966933
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.