DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15253 and CG6974

Sequence 1:NP_609758.1 Gene:CG15253 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650414.1 Gene:CG6974 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster

Alignment Length:219 Identity:74/220 (34%)
Similarity:106/220 (48%) Gaps:15/220 (7%)


  Fly    39 DMVPSGSSRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKE---ATTDQ 100
            |......:||...:...|||...|.|.|::...|:...::.:|:......:|:.|:|   |....
  Fly    39 DEQAEAKTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAG 103

  Fly   101 KYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVG--CFRLYTIV-HEFLHALGFFHQQSAADR 162
            |.||:.......|.:.:||    |.|:...:|:.:.  |..:..:: ||.||.||.||:||..||
  Fly   104 KRYVSFKKSPNMCGTRVGY----QPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDR 164

  Fly   163 DDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGER-TILALEEGK-- 224
            |:||||..:||.......|....:.|.  |...|||.|||||...||:|:..: ||.||..||  
  Fly   165 DEYVQIDYDNIPRKYWSQFMAMDQTTT--FNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAV 227

  Fly   225 EDVIGQRLELSETDIRKLNAIYKC 248
            |..:||....||.|..|:..:|||
  Fly   228 EREMGQVRGPSEGDWTKIRLMYKC 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 71/204 (35%)
ZnMc_astacin_like 59..246 CDD:239807 65/196 (33%)
CG6974NP_650414.1 Astacin 55..251 CDD:279708 70/202 (35%)
ZnMc_astacin_like 59..249 CDD:239807 65/196 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C128967396
eggNOG 1 0.900 E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D472790at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10127
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.