DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15253 and Semp1

Sequence 1:NP_609758.1 Gene:CG15253 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_609756.1 Gene:Semp1 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster

Alignment Length:228 Identity:104/229 (45%)
Similarity:141/229 (62%) Gaps:8/229 (3%)


  Fly    28 DPELTAGYIEGDMVPSG-SSRNIWRNETYRWPNRIIYYHI--NSYIDEEHRNHIVSAIQKIESIS 89
            ||||.||:.:||:.... .:||...|:.|.||||.:.|.|  :::.|..:| .|:.||..||..|
  Fly    23 DPELLAGFYQGDIKAHPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYR-EILRAISIIEENS 86

  Fly    90 CLTFKEAT-TDQKYYVNVTSEEGGCFS-YIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALG 152
            |:.||.|| .|....:.:||:..||.: ::||.|:.|.:||:...:|.||||:.:|:||.||.||
  Fly    87 CVIFKPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLG 151

  Fly   153 FFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETV-NDFGEKYDYGSVMHYGPYAFSKNGERT 216
            |.||..:.:||.||.|..:||......||......|. :||.|.|||.|||||.|.|||:||:.|
  Fly   152 FEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPT 216

  Fly   217 ILALEEGKEDVIGQRLELSETDIRKLNAIYKCP 249
            |:.|.||.|: :|||..:||.||||||.:|:||
  Fly   217 IVPLREGAEN-MGQRFYMSEKDIRKLNKMYRCP 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 93/201 (46%)
ZnMc_astacin_like 59..246 CDD:239807 87/192 (45%)
Semp1NP_609756.1 Astacin 53..249 CDD:279708 92/199 (46%)
ZnMc_astacin_like 55..245 CDD:239807 87/192 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C128969103
eggNOG 1 0.900 E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D472790at33208
OrthoFinder 1 1.000 FOG0000090
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10127
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.