DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15253 and nas-21

Sequence 1:NP_609758.1 Gene:CG15253 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_505907.2 Gene:nas-21 WormBaseID:WBGene00003540 Length:380 Species:Caenorhabditis elegans

Alignment Length:225 Identity:62/226 (27%)
Similarity:100/226 (44%) Gaps:55/226 (24%)


  Fly    45 SSRNIWR--NETYRWPNRII-YYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNV 106
            |.|...|  ||. |||...| |:......||..|..::.|::||.:.:|:.|  :..|.:..:.:
 Worm    43 SKRQALRMDNEP-RWPRGTINYFFDEQRFDENSRATVLRAMEKISNHTCIKF--SPKDARIKLRI 104

  Fly   107 TSEEGGCFSYIGYLNRVQQ-LNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVE 170
            .|:: ||.:.||.:...|| |:...:...||.      ..|.:|.:||.|....||||:|:::  
 Worm   105 VSDK-GCQAAIGRVGGDQQYLSFPTSCYSVGS------ASELIHVIGFLHSHQRADRDEYLKL-- 160

  Fly   171 ENIT--------EGMEFNFDKYTEETVNDFGEKYDYGSVM-------HYGPYAFSKNGE--RTIL 218
             |:.        :.|::.  ||.::.   :...|||||:|       .|||    ||.:  ||  
 Worm   161 -NLQPWRLNDWFQTMQYK--KYLDQW---WIVPYDYGSIMQYHDSDNEYGP----KNSKYFRT-- 213

  Fly   219 ALEEGKEDVIGQRLELSETDIRKLNAIYKC 248
                     :|.::. |..|...:|..|:|
 Worm   214 ---------MGSQIP-SYFDYLMINEYYQC 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 57/214 (27%)
ZnMc_astacin_like 59..246 CDD:239807 52/206 (25%)
nas-21NP_505907.2 ZnMc 52..192 CDD:214576 44/158 (28%)
ZnMc_astacin_like 59..231 CDD:239807 52/205 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.