DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and toh-1

DIOPT Version :10

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_497769.3 Gene:toh-1 / 175491 WormBaseID:WBGene00006591 Length:414 Species:Caenorhabditis elegans


Alignment Length:271 Identity:76/271 - (28%)
Similarity:117/271 - (43%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SILLLL----LVVVNVAWAAPSIRIETDPELTAGYIEGDMVPSGSS-RNIWRNETYRWPNRII-- 62
            |::|:|    ||.:..|....|.:|...|.|..  :..|..|..:: ..:.|.:.:|....:|  
 Worm     4 SLVLILAPLALVAIGEAAFGNSSKIFEIPGLEV--MASDKYPHFTTIETVSRTKVHRHRREVIAG 66

  Fly    63 -YYHINSYI--------DEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFS-YI 117
             .|..|||.        |...::.|...|:..|..:||.|||....:.....|..:...||: ||
 Worm    67 QIYDWNSYEIPFQIWGGDYNFQSLIRRGIRMWEDSTCLRFKENQQSRDAIRYVLEKGDSCFTEYI 131

  Fly   118 GYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFD 182
            |     :....|:..||..|...|.:.||..|||||:|.....|||.::.|..:|:.|....:|.
 Worm   132 G-----RNGGHQDIIIGSECAEEYVVAHETGHALGFWHTHQRPDRDRHISINWKNVMEEATASFM 191

  Fly   183 KYTEETVNDFGEK--------YDYGSVMHYGPYAFS-KNGERTILALEEGKEDVIGQRLELSETD 238
            .: ...:..||.:        |||||:|||...|.: |..:.||:..|......:|.. :::..|
 Worm   192 PF-RSMLQAFGIRQVSPRRVPYDYGSLMHYHAVAHAVKVSDFTIVPKELKYVTTMGTE-KMAFLD 254

  Fly   239 IRKLNAIYKCP 249
            .:.:|.|| ||
 Worm   255 AKVINDIY-CP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 ZnMc_astacin_like 59..246 CDD:239807 58/207 (28%)
toh-1NP_497769.3 ZnMc_astacin_like 73..262 CDD:239807 55/195 (28%)
CUB 320..410 CDD:214483
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.