DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15253 and LOC108646186

Sequence 1:NP_609758.1 Gene:CG15253 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017947973.1 Gene:LOC108646186 ID: Length:663 Species:Xenopus tropicalis

Alignment Length:117 Identity:27/118 (23%)
Similarity:46/118 (39%) Gaps:20/118 (17%)


  Fly    12 VVVNVAW-AAPSIRIETDPELTAGYIE---GDMVPSGSSRNIWR-NETYRWPNRIIYYHINSYID 71
            :|.|:.. ..||:.......::...:|   ..::|:..||:..| :||...|.::...|:|.  .
 Frog   146 IVTNIMQKTQPSVSTLASNSISPNTVELTHNALIPTKISRHQHRTDETSTVPEQVTLLHVNE--S 208

  Fly    72 EEHRNHIVSAIQKIESISCLTFKEATTDQKY------YVNVTSEEGGCFSYI 117
            .||..       ..||...||...::....|      |.|:|..||...:|:
 Frog   209 TEHGT-------PTESNQILTENVSSKPTPYPPEHLDYSNLTKSEGENLNYV 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 16/70 (23%)
ZnMc_astacin_like 59..246 CDD:239807 15/66 (23%)
LOC108646186XP_017947973.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.