DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and astl2d.2

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_031756346.1 Gene:astl2d.2 / 105947175 XenbaseID:XB-GENE-22069740 Length:517 Species:Xenopus tropicalis


Alignment Length:218 Identity:73/218 - (33%)
Similarity:118/218 - (54%) Gaps:16/218 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IEGDMVPSGSSRNIWRNETYRW--PNRIIY--YHINSYIDEEHRNHIVSAIQKIESISCLTFKEA 96
            ::||:....|...|...:.: |  .|.|:|  |.::.....:..|.|.||::...:::|:.| ..
 Frog    79 VQGDIAVRVSRSTIVCTDCF-WQKSNGIVYVPYTLDKQYSSDQINTITSAMEVYSTLTCVQF-VP 141

  Fly    97 TTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAAD 161
            .||::.|:.:||.: ||:||:|.....|.::::...    |....|.:||..|||||.|:||.:|
 Frog   142 YTDEEDYIAITSGD-GCWSYMGRQGGAQVVSVEKGY----CTSEGTTMHELNHALGFVHEQSRSD 201

  Fly   162 RDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSK-NGERTILALEEGKE 225
            ||:||.|:.:.|:.|...||.|.  || |:....|||.|:|||..:|||. .|:.||:| :....
 Frog   202 RDNYVDIMYQYISPGDIVNFKKM--ET-NNLNTTYDYHSIMHYPAWAFSNTTGQNTIVA-KLNPN 262

  Fly   226 DVIGQRLELSETDIRKLNAIYKC 248
            ..:|....::..||.|:|.:|:|
 Frog   263 TPLGPGSTMTNLDITKINRLYQC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 69/199 (35%)
ZnMc_astacin_like 59..246 CDD:239807 66/189 (35%)
astl2d.2XP_031756346.1 ZnMc 103..285 CDD:412141 67/191 (35%)
CUB 288..399 CDD:238001
CUB 402..513 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.