DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15253 and LOC105947175

Sequence 1:NP_609758.1 Gene:CG15253 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_012817558.1 Gene:LOC105947175 ID: Length:497 Species:Xenopus tropicalis

Alignment Length:218 Identity:73/219 (33%)
Similarity:118/219 (54%) Gaps:16/219 (7%)


  Fly    36 IEGDMVPSGSSRNIWRNETYRW--PNRIIY--YHINSYIDEEHRNHIVSAIQKIESISCLTFKEA 96
            ::||:....|...|...:.: |  .|.|:|  |.::.....:..|.|.||::...:::|:.| ..
 Frog    59 VQGDIAVRVSRSTIVCTDCF-WQKSNGIVYVPYTLDKQYSSDQINTITSAMEVYSTLTCVQF-VP 121

  Fly    97 TTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAAD 161
            .||::.|:.:||.: ||:||:|.....|.::::...    |....|.:||..|||||.|:||.:|
 Frog   122 YTDEEDYIAITSGD-GCWSYMGRQGGAQVVSVEKGY----CTSEGTTMHELNHALGFVHEQSRSD 181

  Fly   162 RDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSK-NGERTILALEEGKE 225
            ||:||.|:.:.|:.|...||.|.  || |:....|||.|:|||..:|||. .|:.||:| :....
 Frog   182 RDNYVDIMYQYISPGDIVNFKKM--ET-NNLNTTYDYHSIMHYPAWAFSNTTGQNTIVA-KLNPN 242

  Fly   226 DVIGQRLELSETDIRKLNAIYKC 248
            ..:|....::..||.|:|.:|:|
 Frog   243 TPLGPGSTMTNLDITKINRLYQC 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 69/200 (35%)
ZnMc_astacin_like 59..246 CDD:239807 66/190 (35%)
LOC105947175XP_012817558.1 ZnMc 83..265 CDD:294052 67/192 (35%)
Astacin 88..265 CDD:279708 64/187 (34%)
CUB 268..379 CDD:238001
CUB 382..493 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D681837at2759
OrthoFinder 1 1.000 FOG0000090
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.