DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and astl2d.4

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_004913426.2 Gene:astl2d.4 / 101734297 XenbaseID:XB-GENE-22069748 Length:537 Species:Xenopus tropicalis


Alignment Length:220 Identity:73/220 - (33%)
Similarity:117/220 - (53%) Gaps:20/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IEGDMVPSGSSRNIWRNETYRWP--NRIIYYHINSYIDEEHRNH----IVSAIQKIESISCLTFK 94
            ::|| :..|.||:........||  |..:|  :...:|:|:.|:    |.:|:|...:::|:.| 
 Frog    99 VQGD-IAIGVSRSALNCTNCLWPKTNGTVY--VPYTLDDEYSNNEVNTITAAMQVYATLTCVQF- 159

  Fly    95 EATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSA 159
            ...||:..||.:.| ..||:||:|.....|.::::...    |....|.:||..|||||.|:||.
 Frog   160 VPYTDEDDYVAIKS-ANGCWSYMGRQGGAQVVSVEKGY----CTSEGTTMHELNHALGFVHEQSR 219

  Fly   160 ADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSK-NGERTILALEEG 223
            :|||:||.|:.:.|:.|...||:......:|..   |||.|:|||..:|||. .|:.||:| :..
 Frog   220 SDRDNYVNIMYQYISPGDIVNFEIMNTNNLNTI---YDYRSIMHYPAWAFSNTTGQNTIVA-KPN 280

  Fly   224 KEDVIGQRLELSETDIRKLNAIYKC 248
            ...:||....::..||.|:|.:|:|
 Frog   281 PNIIIGAGSTMTSLDIIKINRLYEC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 68/201 (34%)
ZnMc_astacin_like 59..246 CDD:239807 64/191 (34%)
astl2d.4XP_004913426.2 ZnMc_hatching_enzyme 123..305 CDD:239810 65/193 (34%)
CUB 308..417 CDD:395345
CUB 422..533 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.