DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15253 and LOC101734297

Sequence 1:NP_609758.1 Gene:CG15253 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017948769.1 Gene:LOC101734297 ID: Length:546 Species:Xenopus tropicalis

Alignment Length:220 Identity:73/221 (33%)
Similarity:117/221 (53%) Gaps:20/221 (9%)


  Fly    36 IEGDMVPSGSSRNIWRNETYRWP--NRIIYYHINSYIDEEHRNH----IVSAIQKIESISCLTFK 94
            ::|| :..|.||:........||  |..:|  :...:|:|:.|:    |.:|:|...:::|:.| 
 Frog   115 VQGD-IAIGVSRSALNCTNCLWPKTNGTVY--VPYTLDDEYSNNEVNTITAAMQVYATLTCVQF- 175

  Fly    95 EATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSA 159
            ...||:..||.:.| ..||:||:|.....|.::::...    |....|.:||..|||||.|:||.
 Frog   176 VPYTDEDDYVAIKS-ANGCWSYMGRQGGAQVVSVEKGY----CTSEGTTMHELNHALGFVHEQSR 235

  Fly   160 ADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSK-NGERTILALEEG 223
            :|||:||.|:.:.|:.|...||:......:|..   |||.|:|||..:|||. .|:.||:| :..
 Frog   236 SDRDNYVNIMCQYISPGDIVNFEIMNTNNLNTI---YDYRSIMHYPAWAFSNTTGQNTIVA-KPN 296

  Fly   224 KEDVIGQRLELSETDIRKLNAIYKC 248
            ...:||....::..||.|:|.:|:|
 Frog   297 PNIIIGAGSTMTSLDIIKINRLYEC 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 68/202 (34%)
ZnMc_astacin_like 59..246 CDD:239807 64/192 (33%)
LOC101734297XP_017948769.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D681837at2759
OrthoFinder 1 1.000 FOG0000090
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.