DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15253 and LOC100496293

Sequence 1:NP_609758.1 Gene:CG15253 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_012810041.1 Gene:LOC100496293 XenbaseID:XB-GENE-5917670 Length:303 Species:Xenopus tropicalis

Alignment Length:137 Identity:50/138 (36%)
Similarity:76/138 (55%) Gaps:9/138 (7%)


  Fly   113 CFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGM 177
            |:||:|.....|.::::...    |....|.:||..|||||.|:||.:|||:||.|:.:.|:.|.
 Frog     6 CWSYMGRQGGAQVVSVEKGY----CTSEGTTMHELNHALGFVHEQSRSDRDNYVNIMYQYISPGD 66

  Fly   178 EFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSK-NGERTILALEEGKEDVIGQRLELSETDIRK 241
            ..||:......:|..   |||.|:|||..:|||. .|:.||:| :.....:||....::..||.|
 Frog    67 IVNFEIMNTNNLNTI---YDYRSIMHYPAWAFSNTTGQNTIVA-KLNPNIIIGAGSTMTSLDIIK 127

  Fly   242 LNAIYKC 248
            :|.:|:|
 Frog   128 INRLYEC 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 50/138 (36%)
ZnMc_astacin_like 59..246 CDD:239807 48/134 (36%)
LOC100496293XP_012810041.1 ZnMc <4..134 CDD:294052 49/136 (36%)
CUB 137..246 CDD:278839
CUB 251..>296 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D472790at33208
OrthoFinder 1 1.000 FOG0000090
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.