DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and WIP4

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_188724.2 Gene:WIP4 AraportID:AT3G20880 Length:412 Species:Arabidopsis thaliana

Alignment Length:445 Identity:89/446 (20%)
Similarity:130/446 (29%) Gaps:176/446 (39%)


  Fly   161 NYNNNLLKSIAE---------YEDCMKMQNIKEEIPPIPSPQLFYPPPTPLAEPEDLSVTQRRVL 216
            ||:.|...|::.         |.......||.|      :|.|..|...||.|            
plant    81 NYSFNYATSLSRIYNSHDSFYYPHQTTNPNINE------NPNLTSPDSPPLRE------------ 127

  Fly   217 SENMNLQNVARALLSMQHMAPQHAPPPID------MEEDQENQDINQLKIKSSNDLYYQCQQCNK 275
                     |..|||:..: .:|..|..:      ||..:.:.:.|.|            .||..
plant   128 ---------ALPLLSLSPI-HKHQEPTANHHEYYFMETTETSSNSNFL------------DQCQD 170

  Fly   276 CYATYAGLVKHQQTHAYESTEYKIIRSQPGGSGA---IVDQTEFCTDQASALIQAANVASAQSMQ 337
            .|       :|..|   ......:.....|||.:   ::|.|:.......               
plant   171 SY-------RHDVT---VDLHLGLPNLGDGGSSSSDVVLDSTDHQEGHHD--------------- 210

  Fly   338 KPVGVPRYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKV--------------FSCKNCDKT 388
                    |.||.|...:.   .|.|...|.....||.:...              |||..|.||
plant   211 --------HHQDQGLEVTM---ASDHDDEHGGLQRGNHLHHFWIPTPSQILMGPTQFSCPLCFKT 264

  Fly   389 YVSLGALKMHIRTH--------------------TLPCKC--PICGKAFSRP--------WLLQG 423
            :.....::||:..|                    .|||.|  |.|......|        ..||.
plant   265 FNRYNNMQMHMWGHGSQYRKGPESLRGTQPTAMLKLPCYCCAPGCKNNIDHPRARPLKDFRTLQT 329

  Fly   424 HIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQSGCQTE 488
            |.:...|.:||:|:.|.:|||.:.:.|.|.:...  |.:.| :|...|       ||.:|     
plant   330 HYKRKHGVRPFACRRCGKAFAVKGDWRTHEKNCG--KLWYC-SCGSDF-------KHKRS----- 379

  Fly   489 QSGGPSGSGGGFDQQQLQQHLQVYEEGHNPHQLYYAGSVGSSNGEEEEGGEYQMQ 543
                            |:.|::.:..||.|       ..|..:.|||...:.:.|
plant   380 ----------------LKDHVKAFGNGHVP-------CCGIDHEEEEAASDVEQQ 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 5/20 (25%)
C2H2 Zn finger 317..334 CDD:275368 0/17 (0%)
zf-C2H2 345..367 CDD:278523 6/22 (27%)
C2H2 Zn finger 347..367 CDD:275368 5/20 (25%)
PHA00732 379..>417 CDD:177300 15/74 (20%)
C2H2 Zn finger 382..402 CDD:275368 6/20 (30%)
zf-C2H2_8 405..482 CDD:292531 25/87 (29%)
zf-C2H2 406..428 CDD:278523 8/32 (25%)
C2H2 Zn finger 408..428 CDD:275368 7/30 (23%)
zf-H2C2_2 421..444 CDD:290200 10/23 (43%)
zf-C2H2 434..456 CDD:278523 8/22 (36%)
C2H2 Zn finger 436..456 CDD:275368 7/20 (35%)
zf-H2C2_2 448..473 CDD:290200 6/25 (24%)
C2H2 Zn finger 464..481 CDD:275368 5/17 (29%)
WIP4NP_188724.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2553
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.