DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and SNAI2

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_003059.1 Gene:SNAI2 HGNCID:11094 Length:268 Species:Homo sapiens

Alignment Length:185 Identity:114/186 (61%)
Similarity:130/186 (70%) Gaps:17/186 (9%)


  Fly   301 RSQPGGSGAIVDQTEFCTDQASALIQAANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKHQQ 365
            :...|....|.|:.|             .:.|..|....:...::.|..|.|:|||:|||:||:|
Human    97 KDHSGSESPISDEEE-------------RLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ 148

  Fly   366 FHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKAFSRPWLLQGHIRTHTG 430
            .||.:    |.:|.||||.|||.||||||||||||||||||.|.|||||||||||||||||||||
Human   149 LHCDA----QSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTG 209

  Fly   431 EKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQSGC 485
            ||||||.|||||||||||||||:|||||||||.|..|:|:|||||||.||.:|||
Human   210 EKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGC 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368
C2H2 Zn finger 317..334 CDD:275368 1/17 (6%)
zf-C2H2 345..367 CDD:278523 12/22 (55%)
C2H2 Zn finger 347..367 CDD:275368 12/20 (60%)
PHA00732 379..>417 CDD:177300 33/38 (87%)
C2H2 Zn finger 382..402 CDD:275368 18/20 (90%)
zf-C2H2_8 405..482 CDD:292531 66/77 (86%)
zf-C2H2 406..428 CDD:278523 20/22 (91%)
C2H2 Zn finger 408..428 CDD:275368 19/20 (95%)
zf-H2C2_2 421..444 CDD:290200 22/23 (96%)
zf-C2H2 434..456 CDD:278523 20/22 (91%)
C2H2 Zn finger 436..456 CDD:275368 18/20 (90%)
zf-H2C2_2 448..473 CDD:290200 19/25 (76%)
C2H2 Zn finger 464..481 CDD:275368 12/17 (71%)
SNAI2NP_003059.1 SNAG domain. {ECO:0000250} 1..20
SFP1 <101..182 CDD:227516 43/98 (44%)
C2H2 Zn finger 130..150 CDD:275370 12/20 (60%)
C2H2 Zn finger 161..181 CDD:275368 18/20 (90%)
C2H2 Zn finger 187..207 CDD:275368 19/20 (95%)
zf-H2C2_2 200..223 CDD:316026 22/23 (96%)
zf-C2H2 213..235 CDD:306579 20/22 (91%)
C2H2 Zn finger 215..235 CDD:275368 18/20 (90%)
C2H2 Zn finger 243..259 CDD:275368 11/16 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146027568
eggNOG 1 0.900 E1_KOG2462
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130148
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3546
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.