DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and Sry-delta

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_524581.1 Gene:Sry-delta FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster

Alignment Length:383 Identity:88/384 (23%)
Similarity:142/384 (37%) Gaps:106/384 (28%)


  Fly   207 DLSVTQRRVLSENMNLQNVARALLSMQHMAPQHAPPPIDMEED--QENQDINQLKIKSSNDLYYQ 269
            :|..||:|:.::       .:..|..:...|:..       ||  .|..:|.|..:::..|.   
  Fly    77 NLMTTQKRLTTQ-------LKGALKSEFEVPESG-------EDILVEEVEIPQSDVETDADA--- 124

  Fly   270 CQQCNKCYATYAGLVKHQQTHAYESTEYKIIRSQPGGSGAIVDQTE----------FCTD----Q 320
                 :..|.:..|||.|     |.::.:|.|.       .||:.|          .|.|    .
  Fly   125 -----EADALFVELVKDQ-----EESDTEIKRE-------FVDEEEEEDDDDDDEFICEDVDVGD 172

  Fly   321 ASALIQAANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKH-------QQFH-CPSA------ 371
            :.||...::....:..:|.|   :..|..|||.|:::..|.||       |..| ||..      
  Fly   173 SEALYGKSSDGEDRPTKKRV---KQECTTCGKVYNSWYQLQKHISEEHSKQPNHICPICGVIRRD 234

  Fly   372 -----------EGNQVKKVFSCKNCDKTYVSLGALKMHIRTH--TLPCKCPICGKAFSRPWLLQG 423
                       ||...|:   |:.|.|::........|:|.|  ....:|..||..||:..||..
  Fly   235 EEYLELHMNLHEGKTEKQ---CRYCPKSFSRPVNTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYN 296

  Fly   424 H-IRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVK-KYSCPTCTKSFSRMSLLAKHLQS--- 483
            | :|....|.|..|..||.:|..|.....|...|.:.: ::.|..|.|||:....|..|:::   
  Fly   297 HRLRHEAEENPIICSICNVSFKSRKTFNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHEG 361

  Fly   484 ----GCQTEQSGGPSGSGGGFDQQQLQQHLQVYEEGHNPHQLYYAGSVGSSNGEEEEG 537
                |.:.|   .|:      |:||:.:.|.|     :..:...|.:|..|:.:|..|
  Fly   362 DVVYGVREE---APA------DEQQVVEELHV-----DVDESEAAVTVIMSDNDENSG 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 5/20 (25%)
C2H2 Zn finger 317..334 CDD:275368 4/21 (19%)
zf-C2H2 345..367 CDD:278523 9/29 (31%)
C2H2 Zn finger 347..367 CDD:275368 9/27 (33%)
PHA00732 379..>417 CDD:177300 11/40 (28%)
C2H2 Zn finger 382..402 CDD:275368 5/20 (25%)
zf-C2H2_8 405..482 CDD:292531 25/79 (32%)
zf-C2H2 406..428 CDD:278523 9/23 (39%)
C2H2 Zn finger 408..428 CDD:275368 9/21 (43%)
zf-H2C2_2 421..444 CDD:290200 9/24 (38%)
zf-C2H2 434..456 CDD:278523 6/22 (27%)
C2H2 Zn finger 436..456 CDD:275368 6/20 (30%)
zf-H2C2_2 448..473 CDD:290200 7/26 (27%)
C2H2 Zn finger 464..481 CDD:275368 7/17 (41%)
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 41/158 (26%)
C2H2 Zn finger 225..245 CDD:275368 2/20 (10%)
C2H2 Zn finger 253..273 CDD:275368 5/20 (25%)
C2H2 Zn finger 281..301 CDD:275368 9/20 (45%)
C2H2 Zn finger 310..327 CDD:275370 6/17 (35%)
zf-C2H2 337..359 CDD:278523 7/22 (32%)
C2H2 Zn finger 339..359 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.