DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and CG4424

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster

Alignment Length:284 Identity:79/285 (28%)
Similarity:113/285 (40%) Gaps:63/285 (22%)


  Fly   270 CQQCNKCYATYA-------GLVKH--QQ----------THAYESTEYKIIRSQPGGSGAIVDQTE 315
            ||:.|:....|.       |:||.  ||          |...|..|.:::..   |..:..|..|
  Fly    82 CQRSNEFLREYVIKDAVEQGVVKEVVQQTRPSTPPPIETEQLEPPEDEVLEE---GVWSTEDPIE 143

  Fly   316 FCTDQASALIQAANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVK-KV 379
            . |....|..:...|.:.:.:..|...|.          ||           .|.|....|| |:
  Fly   144 E-TPHGPAEKERPTVLTVEMLPAPYPPPA----------ST-----------PPPAPAGAVKGKL 186

  Fly   380 FSCKNCDKTYVSLGALKMHIRTHT--LPCKCPICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRA 442
            ..|..|...|.....|..|:|.|.  .|.:|.||.|:|...:.|:.|||.|||.||::||:|.|.
  Fly   187 HVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQRN 251

  Fly   443 FADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQSG-------CQTEQSGGPSGSGGGF 500
            ||||::|..|.:||.:.:.|:|.||.|.|:..|:|..|.::.       ||.        ....|
  Fly   252 FADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQL--------CNKSF 308

  Fly   501 DQ-QQLQQHLQVYEEGHNPHQLYY 523
            .: ..|..|||..:..::|....|
  Fly   309 ARIHNLVAHLQTQQHINDPRLTAY 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 10/39 (26%)
C2H2 Zn finger 317..334 CDD:275368 3/17 (18%)
zf-C2H2 345..367 CDD:278523 2/22 (9%)
C2H2 Zn finger 347..367 CDD:275368 2/20 (10%)
PHA00732 379..>417 CDD:177300 13/40 (33%)
C2H2 Zn finger 382..402 CDD:275368 6/20 (30%)
zf-C2H2_8 405..482 CDD:292531 36/77 (47%)
zf-C2H2 406..428 CDD:278523 9/22 (41%)
C2H2 Zn finger 408..428 CDD:275368 9/20 (45%)
zf-H2C2_2 421..444 CDD:290200 14/23 (61%)
zf-C2H2 434..456 CDD:278523 11/22 (50%)
C2H2 Zn finger 436..456 CDD:275368 11/20 (55%)
zf-H2C2_2 448..473 CDD:290200 10/25 (40%)
C2H2 Zn finger 464..481 CDD:275368 8/17 (47%)
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 3/10 (30%)
C2H2 Zn finger 189..209 CDD:275368 6/20 (30%)
DUF45 <204..281 CDD:302795 36/77 (47%)
COG5048 210..>345 CDD:227381 45/132 (34%)
C2H2 Zn finger 217..237 CDD:275368 9/20 (45%)
C2H2 Zn finger 245..265 CDD:275368 11/20 (55%)
zf-H2C2_2 257..282 CDD:290200 10/25 (40%)
C2H2 Zn finger 273..293 CDD:275368 8/20 (40%)
zf-H2C2_2 286..310 CDD:290200 5/32 (16%)
C2H2 Zn finger 301..320 CDD:275368 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.